SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8K6N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8K6N6
Domain Number 1 Region: 7-62
Classification Level Classification E-value
Superfamily XseB-like 0.00000000000000144
Family XseB-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8K6N6
Sequence length 84
Comment (tr|A0A0L8K6N6|A0A0L8K6N6_STRVR) Exodeoxyribonuclease VII small subunit {ECO:0000256|HAMAP-Rule:MF_00337} KW=Complete proteome OX=1938 OS=Streptomyces viridochromogenes. GN=ADK34_22455 OC=Streptomyces.
Sequence
MAAGTEEAALGYEEARDELIEVVRRLEAGGTTLEESLALWERGEELAKVCRRRLEGARAR
LDASLATERATEAEEAGGEDEDAG
Download sequence
Identical sequences A0A0L8K6N6
WP_033201346.1.28093 WP_033201346.1.63210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]