SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8MVP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8MVP3
Domain Number 1 Region: 13-117
Classification Level Classification E-value
Superfamily HisI-like 1.96e-47
Family HisI-like 0.0000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8MVP3
Sequence length 122
Comment (tr|A0A0L8MVP3|A0A0L8MVP3_STRVG) Phosphoribosyl-AMP cyclohydrolase {ECO:0000256|HAMAP-Rule:MF_01021, ECO:0000256|SAAS:SAAS00976554} KW=Complete proteome OX=1961 OS=Streptomyces virginiae. GN=ADK75_13980 OC=Streptomyces.
Sequence
MSTSPRPGNLDPAIAARLKRSADGLVPAIAQQYDTGEVLMLGWMDDEALHRTLTTGRCTY
WSRSRQEYWVKGDTSGHFQHVKSVALDCDADTLLVRVDQVGAACHTGARTCFDDDVLLRA
AD
Download sequence
Identical sequences A0A0L8MVP3 A0A0M8RX68 A0A1V0R5S2
WP_030385540.1.12662 WP_030385540.1.2302 WP_030385540.1.24860 WP_030385540.1.72023 WP_030385540.1.74674 WP_030385540.1.9715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]