SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8PZA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8PZA1
Domain Number 1 Region: 16-219
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.2e-36
Family Hemopexin-like domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8PZA1
Sequence length 223
Comment (tr|A0A0L8PZA1|A0A0L8PZA1_KITAU) Uncharacterized protein {ECO:0000313|EMBL:KOG80126.1} KW=Complete proteome OX=1894 OS=Kitasatospora aureofaciens (Streptomyces aureofaciens). GN=ADK78_05675 OC=Kitasatospora.
Sequence
MAEQTASPGSFYRRIDAVVRAKGNDPITWVLKDNSYVRYDMKENHGFDGYPKLIEGNWPG
LVDSFGRGIDAALNRRDQPQVVYLFKDSQYVRYDLDSDKVEPGYPLSIAEAWKGLPPDFQ
LGIDAAVNHQSDPNVSWFFKDDLYIRYDVPNDKLLGGPTPILRGWRGLPENFQRGIDAAV
NSVLDTDKVYLFKDDQYVRYDLVSDRTDSGYPLPIEGNWNFFR
Download sequence
Identical sequences A0A0L8PZA1 A0A0X3RI03
WP_030190257.1.16484 WP_030190257.1.19068 WP_030190257.1.21275 WP_030190257.1.23387 WP_030190257.1.29667 WP_030190257.1.40819 WP_030190257.1.44064 WP_030190257.1.47700 WP_030190257.1.55007 WP_030190257.1.64888 WP_030190257.1.65676 WP_030190257.1.69365 WP_030190257.1.72292 WP_030190257.1.7965 WP_030190257.1.82266 WP_030190257.1.83370 WP_030190257.1.86803 WP_030190257.1.92884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]