SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L8VPV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VPV3
Domain Number 1 Region: 1151-1347
Classification Level Classification E-value
Superfamily MIR domain 3.79e-53
Family MIR domain 0.00052
Further Details:      
 
Domain Number 2 Region: 101-132,492-559,631-674
Classification Level Classification E-value
Superfamily TPR-like 0.00000664
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VPV3
Sequence length 1570
Comment (tr|A0A0L8VPV3|A0A0L8VPV3_9SACH) YPP1p Cargo-transport protein involved in endocytosis {ECO:0000313|EMBL:KOH50499.1} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_01742 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MPNSNVRIPPTVPSKIIDVVDQALRARLLGGSTFNSGFDSLDSVLNLQFRLHYHVIGSNG
PAKPVCDVLLKESQNLEKNMSMMEELNDYPEITKLVEKILFNCLAILFFHRGQFQESQRC
LLHSLKIHNNTASQRTALMEQYDRYLIVENLYYRGLVSQDINIMQNVFYKELLAHVDTVP
PESNGLLFEYISLIVAKLRFNQIQDLAENFKTTVENPFILFLYMIKKFQSPLKKHIDNDD
LYLKFGQNVLLKVKFPTASETNDEALEHFNVFLQYYFKFTHIKKIKVNPSWYNFIISSME
KTFQSIEVSKTAMFLFQNLSDNSNDEIKKKTFKRESILNFVNFVKYNDKYYQLHDNSHHD
IISFIDAYSFILQNSSKTDSIENVFDYDNTVSTFATSLNSFYKEYNLPLMSQSESLDWLE
NSTRCVYPGNISKVLTNAWSTLYEIRKCQLDFLVSNNLTSYLCNAMMLSTKEKDNADVEE
QEEGEEEKALRELQFKYSYTLAQQRHIETAIKTLESLILSKNPNYYKAWHLLALCRSVQE
DKEMSYKIVCSVLEAMNESLQNNTLLLNDRWQFIHLKLTQLALIEEIFGTLEALETLPEV
FELYATLFPDSQPKLNSMGPKYSQTKEYLLQMVWIFAANMYMRTKDNDEDAKAAIKEASN
VESKFKNLNCNIANGYLSIIKDEPGVALKEFETVLYYDENNLDALVGFAELIFPEELGVE
ETNLERYYTLSLDKKPGKRAKLTFVNDTDRSAAYARLKFLLECAILESIEAYYSPEVWWY
LSLIYEKYQDDEYKNSLLKCIKYQELNPIRSLSKAKGTGFSSIDTEDENLRERYVNQPKA
NASDIQDEQLDCFEQLEEKHRTKKNEEYTALKILRDVIGPLLLTITSFYLRFQHIDQNNY
VVWDEAHFGKFGSYYIKHEYYHDVHPPLGKMLIALSEWMAGFDGQFDFSSNNAYPENVNF
KLMRQFNATFGALCTPVAFFTAKWMGFNYFTVYLIATMVTLEHSYIVLSKFILLDSMLLF
FSMTTFACMIKLYTLRKQQMTKKWSLWMLLTGLSIGCVCSVKWVGLFITVVVGLYTCIEL
FLLYCGKELPRIKYYKHWLIRIINLIVIPFLIYLYCFKIHFVLLYKSGTGDSTTNTLFQI
NLEGTQIEAGPRDVAFGSELTIRSHGLSPNLLHSHIQVYPEGSGQRQITGYGFADSNNVW
KFEFSRSSGLELDQNGTLNGKIIPITDGVEVRLSHKNTGSNLHSHDVPSHVSRGNYEVSG
YGSQSVGDEKDDWIVEIVKQMDSPNPVYSNENSTILHPVSTFFRLRHKVLGCYLASTGLT
YPAWGFKQAEIVCKDSWSRRDKSTWWNVEDHWNHNLETAEDYVPPKSNFWTDFILTNFAM
ASSNNALVPDEDKYDSLSSDAWEWPTLHKGLRMCSWAGYITRYYLMGSPFNTWISTVSLI
IFPFIILFILYRWRRQTLYLSDDQIWQITIQGIFPFISWMTHYLPFAMMGRVTYVHHYVP
ALYFAMLVFGFVLDFTLTRVHWMVKYPIYLSLFGGCIYIYNLFAPICQGMHGDKAEYLPL
QWLSTWDIAP
Download sequence
Identical sequences A0A0L8VPV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]