SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L8VSH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VSH8
Domain Number 1 Region: 326-512
Classification Level Classification E-value
Superfamily MIR domain 2.88e-60
Family MIR domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VSH8
Sequence length 817
Comment (tr|A0A0L8VSH8|A0A0L8VSH8_9SACH) PMT1p Protein O-mannosyltransferase of the ER membrane {ECO:0000313|EMBL:KOH51396.1} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_00726 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSEEKTYKRVEQDDPVPELDIKQGPVRPFIVTDPSAELASLRTMVTLKEKLLVACLAVFT
AVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDVHPPLAKMLYAGVASLGGFQGDFD
FENIGDSFPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRMWVALMSAICFAVENSYV
TISRYILLDAPLMFFIAAAVYSFKKYEMYPANSLNAYKSLLATGIALGMASSSKWVGLFT
VTWVGLLCIWRLWFMIGDLTKSSKSIFKVAFAKLAFLLGVPFALYLVFFYIHFQSLTLDG
DGASFFSPEFRSTLKNNKIPQNVVADVGIGSIISLRHLSTMGGYLHSHSHNYPAGSEQQQ
ITLYPHMDANNDWLLELYNAPGESLTTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSES
SDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERVIALDTKFRLRHAMTGCYLF
SHEVKLPAWGFEQQEVTCASSGRHDLTLWYVENNSNPLLPEDTKRISYKPASFISKVIES
HKKMWHINKNLVEPHVYESQPTSWPFLLRGISYWGENNRNVYLLGNAIVWWAVTAFIGIF
GLIVITELFSWQLGKPILKDSKVVNFHVQVIHYLLGFAVHYAPSFLMQRQMFLHHYLPAY
YFGILALGHALDIIVSYVFRSKRQMGYAVVITFLAASVYFFKSFSPIIYGTPWTQELCQK
SQWLSGWDYNCNTYFSSLEEYKNQTLTKRESQPAATSTVEEITIEGDGPSYEDLMNEDGK
KIFKDTEGNELDPEVVKKMLEEEGANILKVEKRAVLE
Download sequence
Identical sequences A0A0L8VSH8 C8Z6K9 H0GDQ5 N1P7N5
YDL095W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]