SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L8VVW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VVW1
Domain Number 1 Region: 346-525
Classification Level Classification E-value
Superfamily MIR domain 5.75e-60
Family MIR domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VVW1
Sequence length 759
Comment (tr|A0A0L8VVW1|A0A0L8VVW1_9SACH) PMT2p Protein O-mannosyltransferase of the ER membrane {ECO:0000313|EMBL:KOH52515.1} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_00035 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSSSSSTGYSKNNAAHIKQENTLRQRESSSISVSEELSSADERDAEDFSKEKPAAQSSLL
RLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKML
VGLSGYLAGYNGSWDFPSGEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTV
WLMTVLVLFENSYSTLGRFILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITG
ISLGCTISVKMVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCI
FLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSL
LHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVH
KSTGRNLHTHPVAAPVSKTQWEVSGYGDNVVGDNKDNWVIEIMDQRGDEDPEKLHTLTTS
FRIKNLEMGCYLAQTGNSLPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPED
FQYPKTNFLKDFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNP
KYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWG
LHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMAL
VIGCFWYFSPISFGMEGPSSNFRYLNWFSTWDIADKQEA
Download sequence
Identical sequences A0A0L8VVW1 B3LUV7 C7GPL2 C8Z3K4 E7KJY8 H0GBX0 N1PAZ0 P31382
YAL023C SCRT_05658 YAL023C YAL023C YAL023C YAL023C NP_009379.2.97178 YAL023C 4932.YAL023C YAL023C YAL023C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]