SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0L9Y8N3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L9Y8N3
Domain Number 1 Region: 180-366
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.45e-63
Family Methylesterase CheB, C-terminal domain 0.000016
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily CheY-like 7.54e-28
Family CheY-related 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L9Y8N3
Sequence length 368
Comment (tr|A0A0L9Y8N3|A0A0L9Y8N3_CLOBO) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=1491 OS=Clostridium botulinum. GN=ADT22_16750 OC=Clostridium.
Sequence
MSKIKVIVVDDSAFMRKMISEIIEEDNEIEVVAKLRNGRELIEKVDKFNPDIITLDLEMP
EMDGLETLKELHKKNKNYSIIMLSSLTTKGSEKTMECLENGAIDFITKPSGSISLDIRKV
QENLIEKIKSISRRSIRTRAINKSIDVPKAVIKNTNVYNDAKVKDLKKPEHTNMVTIKNK
KIDAIVIGASTGGPKALQQLLTKFEANIGVPIFVVQHMPQGFTKAFSERLNKICNLKVLE
GEEGLRIENNVIYIAKGGYHMTVGTDGKIHLNEEDPIWGVRPAVDKLFDSAIKAYRGNLI
SVVLTGMGRDGAKGTSNVKDYGGVTISEDESTCTIYGMPKAAFETGKVDLVLPLNNICDE
VTKIVKKR
Download sequence
Identical sequences A0A0L9Y8N3
WP_026140446.1.10246 WP_026140446.1.14003 WP_026140446.1.32697 WP_026140446.1.65636 WP_026140446.1.73899 WP_026140446.1.92433 WP_026140446.1.92626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]