SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M0A5H7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0A5H7
Domain Number 1 Region: 58-154
Classification Level Classification E-value
Superfamily E set domains 1.82e-21
Family E-set domains of sugar-utilizing enzymes 0.016
Further Details:      
 
Weak hits

Sequence:  A0A0M0A5H7
Domain Number - Region: 538-594
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0628
Family Capz beta-1 subunit 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M0A5H7
Sequence length 665
Comment (tr|A0A0M0A5H7|A0A0M0A5H7_CLOBO) Chitinase {ECO:0000313|EMBL:KON11487.1} KW=Complete proteome OX=1491 OS=Clostridium botulinum. GN=ACP52_00725 OC=Clostridium.
Sequence
MSKNFKTLKKANALALSTAILLGVSTPVSALEKNKEEKNFNKIQLKSNSNSYVLNNSKVL
DAQTSAPSDFQLSKDNWDGSPNYTISMDMWYGTNGDAWKLYENGKLVHEVKLVNNSPNAQ
HAEIKLTNKSNGTYTYTAELINAAGVTKSKNTIVHEVTKNDAPIDVPLPESASGYPAVGY
TVLNEDDTNFEWAVFVSNPNKNYIWQGSSFSLWGMSFETDNEITSVSNADSFKQNGKNVI
INVKQDERLLPYNTTRIFVVKGKKHSSKAPTNFKSNLIRGDISYPTFASLPSSFTKNKPD
LNEKDLIANKVDYYNPKAKVNTGNKLMYNNPASDTQLIIPMPKKMLVPINGVNGLRIWMP
SKYLAMGIGTGTEYFGLNPNFMVGLSIKENFTCGLAPLESGYTENIVTVDGQKWSWPIQK
KHPDGPFQQEKGNFNEIKKQYPDYLPDSAEHENYVTLKTGEPDDPSYVHAAMSSYMSLTM
TREFLYAIPNNDFSGVLKDAKDPWAEFVLVDNAYNRGVYGLLQKKLFTEHRDKLINSPDI
NKEFNLSGFANHIENIQNVIKAMDSETESFYDANITWDDMENYFKELRLYYGRNIPNDAD
WNIMKADVKKSYDILSKHWGGDHISLRYDFLTLLRVCEKHLPENKQPGPSGPSWIEQVNS
ANNIH
Download sequence
Identical sequences A0A0M0A5H7 A0A175M604 A5I5R7
gi|153936200|ref|YP_001388544.1| WP_011987102.1.21778 WP_011987102.1.27088 WP_011987102.1.34822 WP_011987102.1.46754 WP_011987102.1.49536 WP_011987102.1.57120 WP_011987102.1.63111 WP_011987102.1.63218 WP_011987102.1.75721 YP_001255331.1.75347 YP_001388544.1.17653 gi|153933456|ref|YP_001385075.1| gi|148380790|ref|YP_001255331.1| 413999.CBO2831 441770.CLB_2775 441771.CLC_2708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]