SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0ESQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0ESQ9
Domain Number 1 Region: 6-84
Classification Level Classification E-value
Superfamily EF2458-like 1.18e-36
Family EF2458-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M0ESQ9
Sequence length 93
Comment (tr|A0A0M0ESQ9|A0A0M0ESQ9_9BACI) UPF0358 protein AKG34_05755 {ECO:0000256|HAMAP-Rule:MF_01560} KW=Complete proteome; Reference proteome OX=421767 OS=Bacillus butanolivorans. GN=AKG34_05755 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MASDMLVNHREKAYALLKADADKILKLIKVQMENLTMPQCPLYEEVLDTQMFGLSREIDF
AVRLGLVEDTEGKSLLETLEKQLSVLHEASLKK
Download sequence
Identical sequences A0A0M0ESQ9 A0A0Q6HI42 A0A0Q9W927
WP_053345198.1.102028 WP_053345198.1.51977 WP_053345198.1.64378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]