SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0FRP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0FRP5
Domain Number 1 Region: 52-125
Classification Level Classification E-value
Superfamily FlaG-like 3.92e-22
Family FlaG-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M0FRP5
Sequence length 125
Comment (tr|A0A0M0FRP5|A0A0M0FRP5_9RHOO) Uncharacterized protein {ECO:0000313|EMBL:KON80233.1} KW=Complete proteome OX=1637998 OS=Azoarcus sp. PA01. GN=PA01_17730 OC=Zoogloeaceae; Azoarcus.
Sequence
MAVEPIGAAASGATAVNARPAAPVTPAAPVVESQATLLTGIKAVQPAEPVPAIDDVRDAV
RKIEDVVSPAAQDLRFSIDDETGITVVKLIDTETQTVLRQIPTEEVMEISKALDKLQGLL
VRNKV
Download sequence
Identical sequences A0A0M0FRP5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]