SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0I0X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0I0X0
Domain Number 1 Region: 7-107
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 2.62e-37
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.00000421
Further Details:      
 
Domain Number 2 Region: 108-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000656
Family Prokaryotic DksA/TraR C4-type zinc finger 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M0I0X0
Sequence length 148
Comment (tr|A0A0M0I0X0|A0A0M0I0X0_9VIBR) RNA polymerase-binding transcription factor DksA {ECO:0000256|HAMAP-Rule:MF_00926} KW=Complete proteome; Reference proteome OX=171383 OS=Vibrio hepatarius. GN=AKJ31_08600 OC=Vibrionaceae; Vibrio; Vibrio oreintalis group.
Sequence
MPESKKKALGILAIAGVEPYQEKPGEEYMSPEQMAHFTKILTAWRNQLREEVERTVHHMQ
DEAANFPDPVDRASQEEEFSLELRNRDRERRLIKKIEKTLDKIEDDDFGFCESCGIEIGI
RRLEARPTADLCIDCKTLAEIKEKQMQG
Download sequence
Identical sequences A0A0M0I0X0
WP_053408698.1.13632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]