SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0IJH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0IJH8
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily XseB-like 3.4e-21
Family XseB-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M0IJH8
Sequence length 80
Comment (tr|A0A0M0IJH8|A0A0M0IJH8_9VIBR) Exodeoxyribonuclease VII small subunit {ECO:0000256|HAMAP-Rule:MF_00337} KW=Complete proteome OX=170661 OS=Vibrio xuii. GN=AKJ18_14345 OC=Vibrionaceae; Vibrio.
Sequence
MASKKPENMTFEATIDELDVIVENLENGDLALEDALKKFERGIALARAGQTKLSDAEQRV
SILLQNDDESPLSDFDGQPE
Download sequence
Identical sequences A0A0M0IJH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]