SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0JZY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0JZY7
Domain Number 1 Region: 66-216
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.75e-27
Family C-terminal, gelsolin-like domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 2 Region: 2-65
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 0.0000000000000288
Family Helical domain of Sec23/24 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M0JZY7
Sequence length 220
Comment (tr|A0A0M0JZY7|A0A0M0JZY7_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KOO32211.1} KW=Complete proteome; Reference proteome OX=1460289 OS=Chrysochromulina sp. CCMP291. GN=Ctob_009474 OC=Chrysochromulina.
Sequence
MCASASTAAGQLILPESLKLLPLYTLSLTKNGVLRAGTDVRADERNALMAAGSRMPVASS
VAFVYPRLFGVHTLDEYACALEADGTPRLPSMTSLSVEKLEADGAFLLDDATALYLWIGR
GVPAAFLEQLLRVRTLEGYDCSRLRVPTLDNDVSIRANRLVNAVRSQRPQLFQSVRVLTA
KDPLEGRFLSMLTEDRAQTAMSYVEFLCHVHRQIQQKFTT
Download sequence
Identical sequences A0A0M0JZY7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]