SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0KR10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0KR10
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily FlaG-like 1.22e-29
Family FlaG-like 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M0KR10
Sequence length 109
Comment (tr|A0A0M0KR10|A0A0M0KR10_9BACL) Flagellar protein FlaG {ECO:0000313|EMBL:KOO41276.1} KW=Complete proteome OX=86667 OS=Jeotgalibacillus marinus. GN=AMC98_14750 OC=Jeotgalibacillus.
Sequence
MNIERLTTLQPVWDRYDTQIHNQKDHESVVPVQQVSYTNLAEMVGEMNKLLEPSQVHLKF
ELHEKLNEYYVQVIEDSTNEVIREIPPKRWLDFYAAMTEFLGLFVDEKK
Download sequence
Identical sequences A0A0M0KR10
WP_041521081.1.83369 WP_041521081.1.95507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]