SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M0LEC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0LEC9
Domain Number 1 Region: 194-381
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-56
Family Methylesterase CheB, C-terminal domain 0.00000835
Further Details:      
 
Domain Number 2 Region: 6-113
Classification Level Classification E-value
Superfamily CheY-like 3.56e-29
Family CheY-related 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M0LEC9
Sequence length 382
Comment (tr|A0A0M0LEC9|A0A0M0LEC9_9BACL) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=263475 OS=Viridibacillus arvi. GN=AMD00_12905 OC=Viridibacillus.
Sequence
MNISQPKKLLIVDDSAFMRKLISDFFTDNTKIQVIGTARNGNDALRKIKSLKPDVVTMDV
EMPEMNGLEALKKIMAESPVPVVMLSSTTERGADSTLEAMANGAVDFIAKPSGTISLDLH
KIKNDLVYKVEHAANVQVSKLQQTIIKSNTTKFTGELSDSTLLSRKVPKVLQQERKAEIA
ATQVKKEWSAHSKKMILIGTSTGGPRALQEVITKIPATIKAPILIVQHMPAGFTKSLSNR
LDQLSDITVKEAENGDILQNGVAYIAPGGYHMKIRKIGMSYGIVLDDQEPPRGGHRPSVD
VLFEDNCQFNEIDKVAVIMTGMGADGTKGLIQLKNTGKVIAITESANTCIVYGMPKAAFE
TGLVDEVADVDDIAETIMKYLP
Download sequence
Identical sequences A0A0M0LEC9
WP_053417454.1.85627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]