SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M1J8W9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M1J8W9
Domain Number 1 Region: 18-205
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.84e-58
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 218-289
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000445
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M1J8W9
Sequence length 301
Comment (tr|A0A0M1J8W9|A0A0M1J8W9_9GAMM) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1604835 OS=Achromatium sp. WMS2. GN=TI04_07865 OC=Thiotrichaceae; Achromatium.
Sequence
MDNLPDVPSKSLSIQSSTPMYYVAVGASAGGLEAIEAFFKHMPLDTGLAFILVQHLSPDY
KSLMPELLENRTEIPVFRAENNMQVLANHIYLITPRKNLTIFHGRLLLQDQERSGGLNLP
IDIFFKSLSEDQGEKAIGIILSGTGSDGTRGARAIKEVGGMVMVQSEESAKFDGMPRSVI
ATGLADFILTPEDMAAQLQAYSKHPYANPLKRNVLPITNEEGMTRIFALLRERSRIDFTF
YKPSTIVRRIERRMMVNHIQDIPSYVRFLSEHFNEVEVLYQDLLIGVTSFMRDPLAFEVL
S
Download sequence
Identical sequences A0A0M1J8W9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]