SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M1YTV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0M1YTV7
Domain Number - Region: 48-99
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0863
Family Capz alpha-1 subunit 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M1YTV7
Sequence length 581
Comment (tr|A0A0M1YTV7|A0A0M1YTV7_9LEPT) Putative transferase, LIC12162 family {ECO:0000313|EMBL:EMO84879.1} KW=Complete proteome OX=1193056 OS=Leptospira santarosai str. AIM. GN=LEP1GSC070_2033 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MKRYLITTADERTWIFDRPVLFLGQWCLRYDRKHVWSNLKFEVAVPYGVNPIIKKRDLDY
LNDLNEVFLSEISGMMNKLHSVSHSNQYWNLVLGHWIQRYLRAFYNRYKTIEQALDRYEI
SGTVSLEFDLFELASNDSIGFIFDVNKDFWNHILNVEILKFFGVKFIDYKNELAYEKNTK
RQYVDSGAVWKRFLLYTINNILPLFSRKSDAFLINTYLPFRSEIFLQLKLKQFPQIWKNR
GIPEWDINEESRSLLNFPISTRQNFETFAWRTLSKVIPRCFVEGYKDILMDSKKINWPQK
PRFIFTSNSFDTDELFKVWLAEKVSQGIPYFVGQHGNNYGTLYGSQNLPEIIDSDRFITW
GWSRNTRKQIPAFVFTKCNESKGVYDPVGDLLLIEFPPAIRLGPEDTWFDFTKYFDEQVD
FYKKLPEKIRKRTIIRLHNSSKHYSWFDEERWKDVDLEVKIDSYQSKLKDLIAKSRLVVH
SYDSTGILETLNLNIPTICFWRNEFAHLVEEAVPFYEKLKEVGIFHSSPRGIVEFISKNW
DTIDLWWFSKDVQDVRLIFCDQYARKVKNPISVLEKIFLGI
Download sequence
Identical sequences A0A0M1YTV7
WP_004491529.1.10978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]