SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M2K3D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M2K3D6
Domain Number 1 Region: 85-148
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 6.02e-26
Family Cyanase C-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000326
Family Cyanase N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M2K3D6
Sequence length 149
Comment (tr|A0A0M2K3D6|A0A0M2K3D6_9MYCO) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_00535} KW=Complete proteome; Reference proteome OX=1807 OS=Mycobacterium obuense. GN=WN67_03225 OC=Mycobacterium.
Sequence
MTPIMPKSEAAELIKAARIRKKLDWSDIAAEIDAPLVWCVAALLGQHPMQAAQAERVCAL
LDLDGAVAESLQLQPSRGIDPALMSDPTIYRFHEALAVYAPALKELIHEEFGDGIMSAIN
FKVDIKRRADPDGDRVVVTFDGKFLDYRW
Download sequence
Identical sequences A0A0M2K3D6
WP_046361635.1.79587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]