SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M2KKI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M2KKI8
Domain Number 1 Region: 9-110
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 1.44e-38
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 111-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000456
Family Prokaryotic DksA/TraR C4-type zinc finger 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M2KKI8
Sequence length 151
Comment (tr|A0A0M2KKI8|A0A0M2KKI8_9GAMM) RNA polymerase-binding transcription factor DksA {ECO:0000256|HAMAP-Rule:MF_00926} KW=Complete proteome; Reference proteome OX=65700 OS=Erwinia tracheiphila. GN=SY86_22275 OC=Erwiniaceae; Erwinia.
Sequence
MQEGQTRKSSSLSILAIAGVEPYQEKPGEEYMNEAQLEHFKKILEAWRNQLRDEVDRTVS
HMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDDDFGYCESCGVE
IGIRRLEARPTADLCIDCKTLAEIREKQMAG
Download sequence
Identical sequences A0A0M2KKI8
WP_016190361.1.116 WP_016190361.1.53624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]