SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M2RAC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M2RAC9
Domain Number 1 Region: 76-105
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000272
Family Prokaryotic DksA/TraR C4-type zinc finger 0.048
Further Details:      
 
Domain Number 2 Region: 4-75
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 0.000017
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M2RAC9
Sequence length 105
Comment (tr|A0A0M2RAC9|A0A0M2RAC9_9PROT) Dimethylmenaquinone methyltransferase {ECO:0000313|EMBL:KKJ76955.1} KW=Complete proteome; Reference proteome OX=1549748 OS=Kiloniella litopenaei. GN=WH95_09755 OC=Kiloniellaceae; Kiloniella.
Sequence
MPDLNMVKANLKTRMEELGVRVDQIEHDLREPHSQDWGENATESEGDQVLEGLEEAGLEE
INQIRAALTRIKNNTYGVCSDCGEAIPEARLVALPYATLCVKCAE
Download sequence
Identical sequences A0A0M2RAC9
WP_046506281.1.61388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]