SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M2U1Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M2U1Q4
Domain Number 1 Region: 69-207
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.2e-45
Family Cobalamin (vitamin B12)-binding domain 0.00023
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Methionine synthase domain 5.23e-21
Family Methionine synthase domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M2U1Q4
Sequence length 209
Comment (tr|A0A0M2U1Q4|A0A0M2U1Q4_9FIRM) Methyltransferase {ECO:0000313|EMBL:KKM09366.1} KW=Complete proteome; Reference proteome OX=1605376 OS=Clostridiales bacterium PH28_bin88. GN=SY88_19195 OC=Bacteria; Firmicutes; Clostridia; Clostridiales.
Sequence
MSILQEMQEAVISGNAGKVKECAEKAVAESIEVSAILNDGLIAGMNVIGVRFKNNEVYVP
EVLVAARAMHAGMAVVKPLIAAADIQEKGTVVIGTVKGDLHDIGKNLVMMMLEGAGYKVI
DLGIDVLSEKFVQAVEEHKPDIVGLSALLTTTMTQMKATVEQLQPYRNRVKVMVGGAPVT
QKFADEIGADAYAPDAASAVDKAQELLAS
Download sequence
Identical sequences A0A0M2U1Q4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]