SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M2X0A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M2X0A3
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.19e-57
Family Methylesterase CheB, C-terminal domain 0.0000696
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M2X0A3
Sequence length 195
Comment (tr|A0A0M2X0A3|A0A0M2X0A3_9LEPT) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=28183 OS=Leptospira santarosai. GN=XB16_2937 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MNYEAIVMGVSAGGMNAMKTILPYLPSEYGIPLILVQHIGPRSDGTWFRILGDLCGIRIK
EAEEKEKIEPGTVYVAPPNYHLLIEKDKTLSLAVTERVNFSRPSIDVLFESASDAYGDRL
IGIVLTGANSDGAKGLKKIKENGGLAIVQDPLCSEASLMPESAIRAGPVDHILSLEKITE
LLIRLDLNNTDRGYT
Download sequence
Identical sequences A0A0M2X0A3
WP_046692095.1.84537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]