SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M2X4M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M2X4M9
Domain Number 1 Region: 162-348
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-62
Family Methylesterase CheB, C-terminal domain 0.00000797
Further Details:      
 
Domain Number 2 Region: 4-118
Classification Level Classification E-value
Superfamily CheY-like 2.42e-26
Family CheY-related 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M2X4M9
Sequence length 355
Comment (tr|A0A0M2X4M9|A0A0M2X4M9_9LEPT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=28183 OS=Leptospira santarosai. GN=BWD14_16840 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MIPNPVRAVIIDDSLLVRNIISDQIQKDSGIHVVATGKTGMDCIDLAQKMNPDVIILDVE
MPVMDGLTALHELQKKKLGIPVIMLSVLTQNGAEATFKALEYGAIDFVPKPSSVFQFDPE
EIGKILKSKILAYFESRVRREVFKKVSVPAKVPVGEAHLKKSPIQAICIGTSTGGPRALQ
EVFSRIPGDISLPILVVQHMPAGFTKAFAMRLNDQSKIKVKEAEDGEPIEPNTGYVAPGD
AHLSIHSKGGRKWIALSRETLVNGHRPSIEVLLNSAIEEYKSGMIGVIMTGMGKDGSAAM
VKVREAGGSTIAQDEQTSVIYGMNRQAVEMGGVEYIEPVTEIINRIQIILKERGI
Download sequence
Identical sequences A0A0E2BHC0 A0A0M1YV75 A0A0M2X4M9 K6J4G2 K8YD95 M5VEP1 M6JNR8 M6UQD1
WP_004458305.1.102048 WP_004458305.1.10732 WP_004458305.1.10978 WP_004458305.1.18401 WP_004458305.1.19286 WP_004458305.1.20664 WP_004458305.1.21210 WP_004458305.1.24014 WP_004458305.1.28466 WP_004458305.1.29418 WP_004458305.1.3512 WP_004458305.1.41926 WP_004458305.1.4226 WP_004458305.1.4626 WP_004458305.1.57426 WP_004458305.1.58894 WP_004458305.1.61177 WP_004458305.1.62320 WP_004458305.1.63257 WP_004458305.1.67782 WP_004458305.1.67987 WP_004458305.1.68471 WP_004458305.1.68538 WP_004458305.1.69976 WP_004458305.1.70806 WP_004458305.1.79523 WP_004458305.1.80262 WP_004458305.1.80937 WP_004458305.1.83002 WP_004458305.1.84537 WP_004458305.1.86625 WP_004458305.1.86790 WP_004458305.1.9422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]