SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3DV79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3DV79
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 8.11e-45
Family H-NOX domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M3DV79
Sequence length 179
Comment (tr|A0A0M3DV79|A0A0M3DV79_9BRAD) Heme NO-binding protein {ECO:0000313|EMBL:KKY10960.1} KW=Complete proteome OX=211460 OS=Afipia massiliensis. GN=YH63_10700 OC=Bradyrhizobiaceae; Afipia.
Sequence
MKGVIFNVLEEVVTQQFSQDVWEDLVDKAGVDGAYTSLGNYADEELVSLVTTSAEVLGKT
PGEILRWFGQSAMPLLATRYPSLFESHQSSRDFVLSVNKIIHPEVRKLYTGASCPFFHFK
PSDNGSMMMAYHSQRKLCMLAQGFIEGAADHYHDHADVHHRECMHNGDEKCLLEIKWAA
Download sequence
Identical sequences A0A0M3DV79
WP_046828018.1.68155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]