SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3IN96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3IN96
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 4.45e-22
Family Bactericidal permeability-increasing protein, BPI 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M3IN96
Sequence length 165
Comment (tr|A0A0M3IN96|A0A0M3IN96_ASCLU) Uncharacterized protein {ECO:0000313|WBParaSite:ALUE_0002022401-mRNA-1} KW=Complete proteome; Reference proteome OX=6252 OS=Ascaris lumbricoides (Giant roundworm). GN= OC=Ascaridoidea; Ascarididae; Ascaris.
Sequence
MRLMPTGLAYLREIGMKVVNDEILRIQLPTITESVDAGQVSIYDAIVTKYWAPPEYSLEL
TPPSMFSWSMAKMHIRASGDFEASFNNPLLLPTVPIQGQFETLLGHIALTIAVKMGRTNS
GTPLVQSTYCHAEVGYVDLNVKNTGVITDFFINSFKGNVCFNEFT
Download sequence
Identical sequences A0A0M3IN96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]