SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M3J0C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3J0C2
Domain Number 1 Region: 348-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000712
Family SPRY domain 0.071
Further Details:      
 
Domain Number 2 Region: 19-77
Classification Level Classification E-value
Superfamily MIR domain 0.00000837
Family MIR domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M3J0C2
Sequence length 492
Comment (tr|A0A0M3J0C2|A0A0M3J0C2_ANISI) Uncharacterized protein {ECO:0000313|WBParaSite:ASIM_0000095901-mRNA-1} KW=Complete proteome; Reference proteome OX=6269 OS=Anisakis simplex (Herring worm). GN= OC=Ascaridoidea; Anisakidae; Anisakis; Anisakis simplex complex.
Sequence
MKIFQDPKKQILDEKEEEGMGVAAIQYGETDAFIQHVKTQLWLSYQTSEVTKKGLGKVEE
KKAVALKDGHMDDCFVFFMALEEESKSARVIRKCSSVLNRFLKGIGALQREGNRANDWTR
VDLREVLKLMEDLIDYFAQPNEADEFEVKQNRLRALRSRQDLFQEEGVLNMILDTIDKFS
QMEALPDFAGLIGEDTQMIWEEISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSN
PQSAEGILDVLYCVLTESPEALNMINEGHIKSVISLLEKVGRDPKVLDVLSSLCEGNGMA
VRSSQNTITQHLLPGKDLLLQTKMRDHVSSMVPNILVGVVEGSAQFRRWYFEAEVEHLEQ
MTNTTPYLRIGWANTVGYKPFPGSGDGWGCNGVGDDFYSYGFDGCSIFYAGKGRQIGNAP
LCKGDIVGCALDLTIPEIRFTVNGMPTFGCFKNFNVDGYFFPVMSLSAKVRSIMCTTRAF
PSFAPKRFLGQH
Download sequence
Identical sequences A0A0M3J0C2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]