SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M3JJG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3JJG5
Domain Number 1 Region: 9-57
Classification Level Classification E-value
Superfamily MIR domain 0.00000000000000353
Family MIR domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M3JJG5
Sequence length 82
Comment (tr|A0A0M3JJG5|A0A0M3JJG5_ANISI) Uncharacterized protein {ECO:0000313|WBParaSite:ASIM_0000778501-mRNA-1} KW=Complete proteome; Reference proteome OX=6269 OS=Anisakis simplex (Herring worm). GN= OC=Ascaridoidea; Anisakidae; Anisakis; Anisakis simplex complex.
Sequence
MDFYCCEYCSMVIYEGGAAVSQARSLWRVELIRMKWHGALIGWDQVFRIRHITSGRYANQ
YANIESVHVQPTFRHSSLAPSS
Download sequence
Identical sequences A0A0M3JJG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]