SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M4E5A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M4E5A3
Domain Number 1 Region: 19-101
Classification Level Classification E-value
Superfamily Barstar-related 3.53e-19
Family Barstar-related 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M4E5A3
Sequence length 110
Comment (tr|A0A0M4E5A3|A0A0M4E5A3_9ACTN) Ribonuclease inhibitor {ECO:0000313|EMBL:ALC28537.1} KW=Complete proteome OX=1649184 OS=Streptomyces sp. CFMR 7. GN=ABE83_16535 OC=Streptomyces.
Sequence
MALRAEAADEAEPVLPPSLVIDLSGVRTPEELQRLLQRELWFPDFYGRNWAAFWDAITGL
VELPEELVLAGWPTFSAVLPGEARMLRERLDAYLAEYGSRRPVPRRIRYR
Download sequence
Identical sequences A0A0M4E5A3
WP_053560135.1.29880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]