SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M5IFF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M5IFF3
Domain Number 1 Region: 4-258
Classification Level Classification E-value
Superfamily Adenylylcyclase toxin (the edema factor) 2.48e-102
Family Adenylylcyclase toxin (the edema factor) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M5IFF3
Sequence length 258
Comment (tr|A0A0M5IFF3|A0A0M5IFF3_PSEAI) Exoenzyme Y {ECO:0000313|EMBL:ALC04256.1} OX=287 OS=Pseudomonas aeruginosa. GN=exoY OC=Pseudomonadaceae; Pseudomonas.
Sequence
QALALQDLFDAQGVGVPVEHALRMQAVARQTNTVFGIRPVERIVTTLIEEGFPTKGFSVK
GKSSNWGPQAGFICVDQHLSKRENRDTAEIRKLNLAVAKGMDGGAYTQTDLRISQQRLAE
LVRNFGLVADGVGPVRLLTAQGPSGKRYEFEARQQPDGLYRISRLGRSEAVQVLASPACG
LAMTADYDLFLVAPSIEAHGSGGLDARRNTAVRYTPLGAKDPLSEDGFYGREDMARGNIT
PRTRQLVDALNDCLGRGE
Download sequence
Identical sequences A0A0M5IFF3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]