SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M7DD02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M7DD02
Domain Number 1 Region: 155-341
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.67e-68
Family Methylesterase CheB, C-terminal domain 0.000000433
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily CheY-like 3.42e-27
Family CheY-related 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M7DD02
Sequence length 358
Comment (tr|A0A0M7DD02|A0A0M7DD02_9BURK) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=134375 OS=Achromobacter sp. GN=ERS370009_01123 OC=Alcaligenaceae; Achromobacter.
Sequence
MKSIRVLAVDDSALMRNMLSAVVNQQPDMEMVGTAPDAFIARELIKQLNPDVLTLDIDMP
RMDGLEFLSRLMRLRPMPVVMISSLTTRGSKATMTALEHGAVDFLPKPEHRGAENIDSWS
QLVVEKIRVAARAKLAQHTPDARPVLAGIPVRQQSLIAIGSSTGGTEALRRVLMPLPVST
PGIVIAQHMPAGFTYSFAQRLDSLCQIAVREAQDGEPVRPGTALIAPGDRHMEVICQDNG
YRVRLSDAPPVNRHRPSVDVLFDSVARQASKHASAALLTGMGADGARGLLHLRQTGAFTL
AQSEATCVVFGMPREAIALGAAKKVVDLDDISQCLLDSFHKHNSSKTDSRSGDKSHVG
Download sequence
Identical sequences A0A0H3CNB0 A0A0M7DD02
WP_013097812.1.40358 WP_013097812.1.55189 WP_013097812.1.92861 YP_003613789.1.53031 gi|296103643|ref|YP_003613789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]