SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M7H1I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M7H1I6
Domain Number 1 Region: 1-37
Classification Level Classification E-value
Superfamily Ribosomal protein L36 1.31e-16
Family Ribosomal protein L36 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M7H1I6
Sequence length 37
Comment (tr|A0A0M7H1I6|A0A0M7H1I6_9BURK) 50S ribosomal protein L36 {ECO:0000256|HAMAP-Rule:MF_00251, ECO:0000256|RuleBase:RU000571} KW=Complete proteome OX=134375 OS=Achromobacter sp. GN=ERS370012_03724 OC=Alcaligenaceae; Achromobacter.
Sequence
MKVMASVKRICRNCKIIKRHGVVRVICTDPRHKQRQG
Download sequence
Identical sequences A0A0A2N9L9 A0A0M7H1I6 A0A1B6B6K3 A0A1U9K0F5 A0A1Y1PTD0 A0A225MVE9 E8UF59 F4GX21 G4QBN3 J0B5K9 U7UB50 W8WSB6
WP_003805360.1.17957 WP_003805360.1.21018 WP_003805360.1.22391 WP_003805360.1.30284 WP_003805360.1.32922 WP_003805360.1.35909 WP_003805360.1.38086 WP_003805360.1.39016 WP_003805360.1.44220 WP_003805360.1.48981 WP_003805360.1.49442 WP_003805360.1.50949 WP_003805360.1.53927 WP_003805360.1.56497 WP_003805360.1.57511 WP_003805360.1.59239 WP_003805360.1.61068 WP_003805360.1.66619 WP_003805360.1.67836 WP_003805360.1.69223 WP_003805360.1.7465 WP_003805360.1.75447 WP_003805360.1.75747 WP_003805360.1.79536 WP_003805360.1.81259 WP_003805360.1.86332 WP_003805360.1.87501 WP_003805360.1.89846 WP_003805360.1.91448 WP_003805360.1.92828 WP_003805360.1.94800 WP_003805360.1.96186 WP_003805360.1.96482 WP_003805360.1.96903 WP_003805360.1.9726 WP_003805360.1.97389 WP_003805360.1.97529 WP_003805360.1.98439 WP_003805360.1.98606 gi|348590789|ref|YP_004875251.1| gi|319778703|ref|YP_004129616.1| gi|332286122|ref|YP_004418033.1| 2031883488 2032059957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]