SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M8MRH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8MRH7
Domain Number 1 Region: 116-182
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000216
Family VPS37 C-terminal domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M8MRH7
Sequence length 195
Comment (tr|A0A0M8MRH7|A0A0M8MRH7_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KOS15327.1} KW=Complete proteome; Reference proteome OX=77020 OS=Malassezia pachydermatis. GN=Malapachy_2679 OC=Malasseziomycetes; Malasseziales; Malasseziaceae; Malassezia.
Sequence
MDPTGAAQRLAEEYPSIAALPREMLEELASSPETMEQSQTQAQLLEALVDQLPAIQTLNA
EHEALVEQVEAAAARNNALRPELEALRRDTQDAFTKAKQYEHQWPEVERALLEARKRFTP
EAMQVRLHMAVQQLHDETEKLVNDFIDGLPPATSPTSTPMDDTHFVRHYCDLRTRYHLRA
MQYEQYTRQRVQWKA
Download sequence
Identical sequences A0A0M8MRH7
XP_017992959.1.46905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]