SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M8R8W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0M8R8W5
Domain Number - Region: 5-128
Classification Level Classification E-value
Superfamily MIR domain 0.00144
Family MIR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M8R8W5
Sequence length 192
Comment (tr|A0A0M8R8W5|A0A0M8R8W5_STRRM) Uncharacterized protein {ECO:0000313|EMBL:KOT81121.1} KW=Complete proteome OX=1464079 OS=Streptomyces rimosus subsp. pseudoverticillatus. GN=ADK70_26660 OC=Streptomyces.
Sequence
MANELRYGAQIHLQNGYNGWQGGYLDTNSHSSASGGKYQVATADTPTRGKGTGTWEVLSA
TGKAAGQPVVSGDVIYLRNLYGGDGGYLDTNGHATNEQKNAGAKYDVSTSQTRDRAQGTG
RWRIFARTSSPADQNVRIGDVVHLWNLYGDNGGFLETNNTSALTDAKYDLCTNAYYNRSS
DVADWKIHQAQG
Download sequence
Identical sequences A0A0L8NZI4 A0A0M8R8W5 A0A0X3RS05 L8ER88
WP_003982220.1.100537 WP_003982220.1.10659 WP_003982220.1.11843 WP_003982220.1.16484 WP_003982220.1.16806 WP_003982220.1.16854 WP_003982220.1.19068 WP_003982220.1.23387 WP_003982220.1.27584 WP_003982220.1.27877 WP_003982220.1.29142 WP_003982220.1.29667 WP_003982220.1.40819 WP_003982220.1.41790 WP_003982220.1.44064 WP_003982220.1.46139 WP_003982220.1.47700 WP_003982220.1.50199 WP_003982220.1.55007 WP_003982220.1.64888 WP_003982220.1.65676 WP_003982220.1.69365 WP_003982220.1.72292 WP_003982220.1.75076 WP_003982220.1.7965 WP_003982220.1.83370 WP_003982220.1.86519 WP_003982220.1.86803 WP_003982220.1.87188 WP_003982220.1.91872 WP_003982220.1.92884 WP_003982220.1.9496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]