SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M8YZD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8YZD5
Domain Number 1 Region: 31-214
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.57e-51
Family Methylesterase CheB, C-terminal domain 0.00033
Further Details:      
 
Domain Number 2 Region: 294-486
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.31e-48
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00022
Further Details:      
 
Domain Number 3 Region: 229-296
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000484
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0044
Further Details:      
 
Domain Number 4 Region: 831-957
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000586
Family BphP N-terminal domain-like 0.029
Further Details:      
 
Domain Number 5 Region: 711-832
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000137
Family BphP N-terminal domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M8YZD5
Sequence length 1158
Comment (tr|A0A0M8YZD5|A0A0M8YZD5_9ACTN) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=68259 OS=Streptomyces purpurogeneiscleroticus. GN=ADL19_24265 OC=Streptomyces.
Sequence
MHQDFHNAPGGEASEILDGAGTVTAPPFAGPVVGIGASAGGLEALREMLARARPPTGMAF
VIVQHLDPNHESMLAQLLDRQTELEVLQCEGGERIAGDKVYIIPPGRGLVIQNGVLELTH
FVQPRGLRRPIDDFFLSLAVDQQANAACVILSGTGADGTTGLRAIKEHGGVCVVQQPDTA
RYDGMPLSAVGTSLVDFVRPPGEIVDCLTSFFRRRGTDAVDDEARLVADHIDDLCRVIRA
TVGHDFSGYKRTTLVRRVERRMHVLGLESGRAYLGRVRADKTECEALFRDLLINVTRFFR
DAELFELLRERAVEPLLRTRDPEEDIRVWIPGCSSGEEAYSIAMLFADAARRLGLPPAVQ
IFATDIDERMLQIAREATYPAAALADIPAHLRERYVVPHAERFTIAAEIRDLIRFSSHSL
VKDPPFSRVDLLSCRNLLIYFDERLQQSVVPLFHYAVRPGGYLFLGPSESVSRFEHLFPV
IDQHARLFERPPGAPQYPIDLPGSARRGETRRGAREERRGEPSIADETVAVRRVMERYAP
PSMVLNEDGGIIAAYGRLSRYFDFPVTRTGGSSAITLARPGLRDVIGPLLRQTRDARKRV
VVRDVEIRSEYGVQPVELICDPLPDGSMLLVLRDTGAFQAADDLDLIEMDAGGDHVEALE
EELLRTRYKLRSTVEELETTNEELKSSNEEMMSMNEELQSTNEELSTVNDELKTKVEQLT
IANADLRNFFESTDLAVVVLDRALKVRSFTTAATAIFPLQPADRGRPLADVSSRLAGLEY
LHDAQEVCAGGSVIQRRVATRDGDRTLSLRVLPYRLQNGSVDGATLVLTDITEALSLERQ
LAAERERLELAVKAGGIGVWEYSPDAGTVVVDSTAGTIFGLTPDTPHPTAALAASVLPED
RPGFEAALAEAAHGLDEFEARIRVRAADHALRHIRSYGRLTRSGDRKRIVGVCIDVSPEY
ALAETRDLMLREMNHRVKNLFAIIGGMISAGARTHREIGVFATDMRDRISALGRAHSLAD
PSDGQGMSDLAGLIGATLRPYRDHVPTVIEGPLVAINWRHVSSLAMILHEWATNSVKYGA
LGSDDGALSVTWDRQEEGLVLEWCERMARVAEPRPGRGFGTLLVEMSLRQLEATVTRSHD
ASAYRITLHLPELALTRG
Download sequence
Identical sequences A0A0M8YZD5
WP_053610624.1.3059 WP_053610624.1.64947 WP_053610624.1.86888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]