SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M8Z292 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8Z292
Domain Number 1 Region: 271-351
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 3.79e-31
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0000364
Further Details:      
 
Domain Number 2 Region: 9-94
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 1.05e-30
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.0000582
Further Details:      
 
Domain Number 3 Region: 190-270
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase domain 9.02e-22
Family Methylated DNA-protein cysteine methyltransferase domain 0.00043
Further Details:      
 
Domain Number 4 Region: 88-134
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000237
Family AraC type transcriptional activator 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M8Z292
Sequence length 354
Comment (tr|A0A0M8Z292|A0A0M8Z292_9ACTN) 6-O-methylguanine DNA methyltransferase {ECO:0000313|EMBL:KOX47837.1} KW=Complete proteome OX=68259 OS=Streptomyces purpurogeneiscleroticus. GN=ADL19_22400 OC=Streptomyces.
Sequence
MNNGPRSDLSDAERWAALAARDARADGTFVYAVRTTGVYCRPSCAARAARPENVSFHRTC
AEAEAAGFRPCRRCRPDEPGLAARRAEAVVRACRLIESAETMPSLAELARTAGLSTYHFH
RVFKAATGVTPKAYAAAHRAAVVARRLPGAASVTETLYEAGYGAASRFYAGGAPRLGMAP
AAYRTGGAGLRIRFGIGACTLGAILVAATEAGVCAILLGDAPEPLLHDLQSRFPAAEIEG
GDPAFESWMAQVIGLVEAPGSGLDLPLDIRGTAFQQRVWAALRKIPVGSTATYAEIARAI
GLPTAMRAVAQACGANPVAVAIPCHRVVRSDGALSGYRWGVARKRALLDREAEG
Download sequence
Identical sequences A0A0M8Z292
WP_053610465.1.3059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]