SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M8ZFM7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8ZFM7
Domain Number 1 Region: 210-401
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.62e-57
Family Methylesterase CheB, C-terminal domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 25-131
Classification Level Classification E-value
Superfamily CheY-like 1.08e-28
Family CheY-related 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M8ZFM7
Sequence length 405
Comment (tr|A0A0M8ZFM7|A0A0M8ZFM7_9ACTN) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome OX=53367 OS=Asanoa ferruginea. GN=ADL14_12775 OC=Asanoa.
Sequence
MALSPAVAPLRTPPTQSTTSSATAIRVLVADDSAVVRGLVARWIGEAGFELVGTASNGRI
ALELMAKHDPDVVLLDIEMPELDGTTALPRMLAMSPSVQVVMMSTLTTRNADISLKCLAL
GAVDYIAKPESSRGVTTSDTFRVELIERVRVFGSARARNRRPAAAPAGHAPGHHAAPAPV
AVPAAAHPAPAAAARPATPFTLRPKVRNRTQPRALLIGSSTGGPRAVGEMLEGIGAAALR
RLPVLIVQHMPPIFTAVFAEHLSTRTGLPAAEGKAEERVEPGRIYVAPGGRHMGLAAGAG
GPIIKLTDGPPVNFCRPAVDVLFKDAAVVFGAATATVILTGMGSDGTNGARALTEAGGPV
LAQDEATSTVWGMPGSVARAGLAEAVLPLPELATALRALITGQPA
Download sequence
Identical sequences A0A0M8ZFM7 A0A227K956 B1M093
gi|170750427|ref|YP_001756687.1| 426355.Mrad2831_4032 WP_012320960.1.25698 WP_012320960.1.31760 WP_012320960.1.35747 WP_012320960.1.5195 WP_012320960.1.89921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]