SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0M8ZYB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M8ZYB0
Domain Number 1 Region: 197-374
Classification Level Classification E-value
Superfamily MIR domain 6.28e-36
Family MIR domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1024-1163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-19
Family SPRY domain 0.041
Further Details:      
 
Domain Number 3 Region: 603-737
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000127
Family SPRY domain 0.049
Further Details:      
 
Domain Number 4 Region: 4144-4203
Classification Level Classification E-value
Superfamily EF-hand 0.000000122
Family Calmodulin-like 0.069
Further Details:      
 
Domain Number 5 Region: 80-163
Classification Level Classification E-value
Superfamily MIR domain 0.000000392
Family MIR domain 0.024
Further Details:      
 
Domain Number 6 Region: 2217-2302
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000981
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 
Domain Number 7 Region: 1521-1646
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000142
Family SPRY domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M8ZYB0
Sequence length 5082
Comment (tr|A0A0M8ZYB0|A0A0M8ZYB0_9HYME) Ryanodine receptor 44F {ECO:0000313|EMBL:KOX73585.1} KW=Complete proteome; Reference proteome OX=166423 OS=Melipona quadrifasciata. GN=WN51_13662 OC=Apoidea; Apidae; Melipona.
Sequence
EDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLSQCVFVIEQALSVRALQEL
VTAAGSETGKGTGSGHRTLLYGNAILLRHQNSDMYLACLSTSSSNDKLAFDVGLQQHSQG
EACWWTVHPASKQRSEGEKVRVGDDLILVSVATERYLHTTKENDLSVVNASFHVTHWSVQ
PYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPSTWSTAPSQNIVIYEGGSVMSQARSL
WRLELARTKWAGGFINWLHPMRIRHLTTGRYLGVKENNELYLVDRNEGTIETSTFWLRQE
KDDQKIILEDKDLEVIGTPIIKYGDSTVIMQHATSCLWVSYKSYETKKKGVGKVEEKQAV
LHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTQFITGLETLQVDRRASMFFQNVNLN
EMVMCLEDLINYFAQPEDDMEHEEKQNRFRALRNRQDLFQEEGILTIIKGNHTNCAQFAN
SNRLNWLFSRLGSQASSEGTGMLDVLHCVLIDSPEALNMMRDEHIKVIISLLEKHGRDPK
VLDVLCSLCVGNGVAVRSSQNNICDFLLPGKNLLLQTQLVDHVASVRPNIFVGRVENSAL
YQKWYFEVTVDHIEQTTHMMPHLRIGWANTAGYMPYPGGGEKWGGNGVGDDLYSFGFDGA
HLWIGGRKTQVVHNATEPYIRKSDVIGCALDLTVPIITFTFNGSPIMGSFRNFNLDGMFF
PAISCSSKLSCRFLLGGDHGRLKFQPPEEFSPLIESLLPQQILSLDPCFYFGNMNKVVLA
GPWLVEDDTAFVPSPVDTSMVNLPSYVEQIRDKLAENIHEMWAMNKIEAGWMYGEHRDDM
RKIHPCIVQFERLPAAEKRYDTQLAVQTLKTILALGYYITMDKPPSRIKTLRLPNEPFLQ
SSGYKPAPLDLGAITLTPKMEELVDQLAENTHNLWAKERISQGWTYGLNEDSEMRRSPHL
VPYPKVDEAIKKANRDTASETVRTLLVYGYMLEPPTGEQHEALLLEASRLRQLYFRTYRV
EKHYAVSGGKWYFEFEVLTAGPMRVGWAKADCSPGNMLGSDENTWAFDGYNVTNIIDINR
ECQVTKVHAGIHESFGHRYQVGDVVGCFIDVADRTISFSLNGELLMDALGGETSFADVQG
DCFVPAFTLGVGQKAKLTFGQDVNTLKFFTTCGLQEGYEPFCVNMNRPVTFWYTKDQPIF
ENTDDMADTRIDVARIPAGSDTPPCLKISHNMFETMEKANWEFLRLSLPVICQSTFISES
DKLRRWQEIKLRQNKLLSEQVEQAQQAVPSAHIEQIMKSGFSMSDIKGSLPDELFKGRAV
TSELSLTKILFAPGLQRNYSEDAVEADEMMKESPLPMQRNKPARPPRKGSLYGSRGGNMD
NAISEADMNGYGNMNGDIKDDKKKRGRSPFRKLSKEMEDAPLFSRKAKSPDAKSKTPEPP
VRSDVSDKSTKTLSMNKASSRPPQIRISNEKLVPQTDLKVVPPQIPERNAPKAMSVLSWS
GVEAIGNEIFDTECLKLMNEYFYGVRIFPGQDPTHVYVGWVTSQYHLHTKDFNLSRVRKG
SVVITDDYDRPIEQVDRQSCYMVRADELYNEVTQDASGKGASQGMFVGCFVDTATGWVSF
TCEGKETSHKFKMEPDTKLFPAIFVEATSKEILQIELGRTSTTLPLSAAVLQNSERHVIP
QFPPRLKVQCLKPHQWARVPNQSLQVHALKLSDIRGWSMLCEDAISMLALHIPEEDRCID
ILELIEMDKLLSFHAHTLTLYAALCYQSNYRAAHALCQHVDQKQLLYAIRAEYMSGPLRQ
GFYDLLIALHLESHATTMEVCTNEYIIPLGQELKELYENEEMKHSLRYLETESVRPQMKM
TDISDQTIENIRSLYSPFFPLDVVRDYVMTALNEAVEVNQVHNRDPIGGSNENLFLPLLK
LVDRLLLVGMLRNEDIMKLLIMIHPETWDPTFDKEGKDEHKKGLLHMKMAEGAKLQMCYL
LHHLNDIQLRHRVESIIAFSHDFVGDLQSDQLRRYIEIKQSDLPSAVAAKKTREFRCPPR
EQMNAILSFKNMDFEEDPENIPCGEDLIGRMNEFHNNLMSYVSLHALEEAADAVEELAED
VQKPGAIKKLFNFINAVKELEEEPKPEPEPERKTPEEVFRKVLIKTIVSWAEESQIETPK
LTYVINSKTKDDVALMWVGLSQIRALLPVQMSQEEEELVRERLWKLVNNHTFFQHPDLIR
VLRIHENVMAIMMNTLGRRAQAQSDAQTQPQTTEGEPASKEKDTSHEMVVACCRFLCYFC
RTSRQNQKAMFDHFDFLLENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEK
IAIYLSRCGLQSNSELVEKGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLL
IRRPECLGPALRGEGEGLLRAIIDANKMSERIADRRKVHDEAEGTAVTQFEHPLPESDDD
EDYIDTGAAILNFYCTLVDLLGRCAPDSSVIEQGKNESLRARAILRSLVPLDDLQGVLSL
RFTLLNPAAGEEKPKSDTPSGLIPGHKQSIVLFLERVYGIETRELFFKILEEAFLPDLRA
ATMLDRNDGYESDMALAMNRYIGNSILPLLIKHSKFYNEADNYASLLDATLHTVYRLSKN
RMLTKGQREAVSDFLVALTSQMQPSMLLKLLRKLTVDVSKLSEYTTVALRLLTLHYDRCA
KYYGSTGGQGAYGASSDEEKRLTMVLFSNIFDSLSKMDYDPELFGKALPCLTAIGCALPP
DYSLSKNYDDEWYGSKSASAQSPDGPYNPQPINTSSVVLNNDLNQIVQKFSEHYHDAWAS
RKLENGWTYGEQWSEVNKTHPRLKPYNMLNDYERERYKEPVRESLKALLAIGWSVEHAEV
DVPSTNRSSMRRSSKSQGDSASPFNYNPHPVDMTNLTLSREMQNMAERLADNAHDIWAKK
KKEELITCGGGIHPQLVPYDLLTDKEKRKDRERSQEFLKYLQYQGYKLHKPNRGGESEVA
TAGASVELRFAYSLLEKLIAYLDKATINMKLLKPSDTFSRRNSFKTSTRDIKFFSKVVLP
LMEKYFSTHKNYFIAVATATNNVGAASLKEKEMVAALFCKLASLLRSRLAAFGPDVRITV
RCLQVLVKGIDAKSLVKNCPEFIRTSMLTFFNNTADDLGHTILNLQEGKYSHLRGTHLKT
STSLSYINSVVLPVLTAMFDHLASCEYGSDLLLDEIQVASYKMLASLYTLGVDASLTHDR
KYLKTEIERHKPNLGSCLGAFSSCFPVAFLEPHLNKHNPYSLLNRIADHSLEAQDIMTKM
ESSMPTLETILTEVDQFVESEKTYNDVPHVVDIILPLLCSYLPFWWAQGPDNVNPTEGTY
VSMVTSDHMNQLLKNVLKLIKKNIGNENAPWMTRIAAYTQQIIINSSEELLKDPFLPLAE
RVRKRTDNMFHKEESLRGFIKSSTDDTSQVEAQIQEDWQLLVRDIYSFYPLLIKYVDLQR
NHWLRNNIPEAEDLYNHVAAIFNIWSKSQYFLREEQNFISANEIDNMVLIMPTATRRPAA
ISDGTAPSGGGKKKKKHRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCK
DRFLKKMPEYEISEFAKTQLTLPDKIDPADEMSWQHYLYSKLGQKKDSMEPVKAQQLEDV
VARITDMAKVLYGLHMIDHPQQQSKGQYRSVVSIQRKRAVIACFRQTSLHSLPRHRAINI
FARTYYELWLQDENVGQEVMIEDLTQSFEDAELKKMDKAEDEGKPDPLTQLVTTFCRGAM
TERSGALQEDPLYMSYAQIISKSCGEEEEEGEDEGGGGEEEGGASIHEQEMEKQKLLFHQ
TRLANRGVAEMVLLHISACKGLPSEMVMKTLELGISILRGGNIEIQRGMLNHLKEKKDVG
FFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGSEGAAGEKNMHDAEFTCALFRFIQLTCE
GHNLDWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKELIDPAGKANFFK
AIGVASQVFNTLTEVIQGPCAQNQQALAHSRLWDAVGGFLFLFSHMQDKLSKHSSQVDLL
KELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESAGNVELILKYFDMFLKLKDLVS
SPSFLEVDLNNDGWVYPKDFKEKMEQQKSYTNEEIEFLLACCETNHDGKIDYVAFMDRFH
EPAKEIGFNLAVLLTNLSEHMPNEPRLARFLETAGSVLNYFEPYLGRIEILGGNKKIERV
YFEIKESNIEQWEKPQIKESKRTYFYNTVVEAGEKEKLETFINFCEDAIFEMQHASALMA
VEESGGIGKARESSYTYMTDDDEERNKDPIRRGIQTFKDSIYFFFSIFSPSNIKNKIAEM
QQMTFLELFIGFFKMIFYAFYYSGFGVGCVIGYFMKLLLALMKGPHVEEPVVEVKEGEEK
PTRHLPALPPTPDESNLQVQAFGMDITKEEGGQIKIAPHESATSTPQSSIEETGESTPEE
ATGEEGARGEGGDMESPVSLADLLGGEQARAQAAAAAEAAAAQQAAMAAVEAEAKQETIA
EPSGSSIDFSDYTHRVVSFLARNFYNLKYVALVLAFCINFMLLFYKVTSLGDDEDEEGSG
RMADMLAEMSGEGASGSGNGSGIEIGSGSGENESEEEEDEPLEYVEVAEDFYYMAHVIRL
MALLHAIVSLAMLVAYYHLKVPLAIFKREKEIARRVEFDGLYIVETPEEDDIKAHWDKMV
ISAKTFPVNYWDKFVKKKVRQKYSETYDFDYISNLLGMEKTSFSQQEEEGSGLIHFIVNI
DWRYQVWKAGVTITDNAFLYSLWYFTFSILGNYNNFFFAAHLLDVAVGFKTLRTILQSVT
HNGKQLVLTVMLLTIVVYIYTVIAFNFFRKFYIQEEDDEVDKKCHDMLTCFVFHLYKGVR
AGGGIGDEIGEPDGDDYEVYRIMFDITFFFFVIVILLAIIQGKLKKITMSLSNCLIIDAF
GELRDQLENVKTNMESNCFICGLGKEYFDTVPXXFSSNDVNRHGSKFCRFFLMHLINKPD
TEYTGQETYVWNMYQQRCWDFFPVGDCFRKQNEAVEEEAKKK
Download sequence
Identical sequences A0A0M8ZYB0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]