SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M9DFN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M9DFN2
Domain Number 1 Region: 10-125
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.15e-20
Family MJ1460-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M9DFN2
Sequence length 163
Comment (tr|A0A0M9DFN2|A0A0M9DFN2_9LACO) Uncharacterized protein {ECO:0000313|EMBL:KOY79384.1} KW=Complete proteome OX=148814 OS=Lactobacillus kunkeei. GN=RZ72_05250 OC=Lactobacillus.
Sequence
MDNNNLYNKIIDNDSTRPLWGQELLRDVLLNDLLGNDTHSIMYWAGKKIARKFPLKDALD
TVLFFKQSGLGDLSVSSENKHEIKWTLSGDIVAKRIEANPDADFMFESGFLAQIAQQQFG
VISEAEMNPKEEKNGTVLIRVHMDPKHPAPIIEDSVKEFDLKQ
Download sequence
Identical sequences A0A0M9DFN2
WP_053796479.1.90909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]