SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N0BIY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0BIY4
Domain Number 1 Region: 58-226
Classification Level Classification E-value
Superfamily MIR domain 4.45e-53
Family MIR domain 0.00000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N0BIY4
Sequence length 248
Comment (tr|A0A0N0BIY4|A0A0N0BIY4_9HYME) Stromal cell-derived factor 2-like protein 1 {ECO:0000313|EMBL:KOX78222.1} KW=Complete proteome; Reference proteome OX=166423 OS=Melipona quadrifasciata. GN=WN51_09581 OC=Apoidea; Apidae; Melipona.
Sequence
MRQLKGKTKETNKQKKERKKEFLENKQRVFTIVLPTIAAIFVVIAAYVYVKTPKGTQHVT
CGSTLKLMNVDYKVRLHSHDIKYGSGSGQQSVTGTTAKEDGNSYWLVKAGTKKQCTRGTP
IKCGDIIRLEHIATKKNLHSHRVSSPLSGKQEISAYGDNKGEGDNGDNWLLVCQTEFWKR
DEPVMLNHIDTDTYLAVSGKVYGNPITGQIEVIGEYSAWSPHIEWVTTEGVFIHPNDFKA
QHHIHTEL
Download sequence
Identical sequences A0A0N0BIY4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]