SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N0DTZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0DTZ2
Domain Number 1 Region: 204-315
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000628
Family MIR domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N0DTZ2
Sequence length 2978
Comment (tr|A0A0N0DTZ2|A0A0N0DTZ2_9TRYP) Uncharacterized protein {ECO:0000313|EMBL:KPA77804.1} KW=Complete proteome; Reference proteome OX=157538 OS=Leptomonas pyrrhocoris. GN=ABB37_06626 OC=Leishmaniinae; Leptomonas.
Sequence
MATTAAAQPLLYGCLINLYKQSLDGYVVATSSAEAPVGVQVDSPENPLRYEQTAFLLQRG
DLVEASGSRRAGGDVVKYGHTIRLLHYAHQQPLSYHTERPAAGMKGNLRALLEKRGKNTL
KVEKWRIMPRYRLRVEGEPVADGDPVVLQAADGDRYLNVALNVDEEAADNGFLEVSVGED
TQGFLMCLYDGDTSPQMRVPPLRCGDCVTLLHTEEHKYILADPTKKTCVLRTSDSHMADG
DGAATGEANASGEQAVAWYAASKEEISYLSLFVVEAADARKGGALRTRGVRGCYRLKSLS
SGLYLQCGEVAASAAPANGAGGIRGSNGSTAAAAGSNILSSPTFPSGLTGTGTNADLNEL
NSPAGAAVPTASPSGVPASPTAAEEVMSPTRLSAAAAVNGVRAGAGRPVRQTKYTVSLTP
SAKAPGTLFQLHSASSGDEELLANGGRVFLSCVNSKNRKVWVVAGGPAPTDGDDSLEAET
TIASLAHHAKTYGSVLLLGERQKSMRDGIEMRRLQPKALEELYMIRGLLPPLQKYVKEMS
KGIGNPFQVRQARENLRQLQQLCHRAADAEEEAGPEELMNARNVGGGVLNPEWQSKVFQQ
GVGELALRVVKATLECPHVRPEKLSSMDMVYPQTVDASLAASVSAAPVAGVVAGAGAEEK
RNAKGEALSDSGVLPRPSPLPSVTLAASPPTLSATLDDRIGSSPSASFVPMRYSELGELV
ATCFQLVRLLLYNRPRYAEALQGYADFVMQCTYHVPSALKCLAAFYSDNPTFVELPMARH
RLDFFLDMLAKRGREPDVVHLLQLFACCGGEGMVEAQRIILDFFAKNRAVALRLLCPMRR
MPVAPEVREALLSQLPEGSPRFSERAESSPAAAVPDGGGEVAGKDEPEGIHRSRGKFHVG
SPLRLLKLQKTSKASPTTASAVRSPASPTVAESALRLGREVVMVGIPNSLFADPESGGDS
LSIATSTQYRAKSSKLGELLQRAADAEDISALTFFPLEGLSVVMQDWPEVKDVLVPYLVA
QVRLLAALANGKSKATSKPFIFEWLPRLVLVETLKSEALPRQLHAALLELFANVMMDVAG
AGDLREQMLNIRCVITRTGSAADAPAASALQLTMRNVPEELVAAKQVVVRYLRRTLMSGD
ENVAAEYLSVLNLTDALVNIGAFELTEYDTLLRLLVQCVDPSCDDQRTYLEVQSVYDCKS
CALRLMNTLTDVLLVREALNLVDCFRMERRPPTYSQITALNVPATAKNTASGERGEVQRW
FGNGEAEKSAAVAPNGSPGGESSNTYAVEDRTAKPGLTPIAEMFRALLDLANRSHSSVIQ
RQVICLFFRVTNFLEELRATAMRVQLLTSEESIGFYAEIDRTSVALEELTKKSFRRSNTV
ALANSALDALGKFIAKAKYGAVAEKLSMMLHLGVPLQLIRLLTRLTVPLPEASRQLAFKA
VTLMQTMSQNARIREELREAVADASPLVYQNTNYIALLRTLFVSDADNDHAQMPAGLLAD
VVRCLYVLHSTDEAIDFLCDWLAARGASGHVTAHRQQQLWRAIVSDQQAERCIQLRHSWC
SDQGRELREKLLTSDESYDPSGRVATHLKMCRLLFLVANKTEFVKSEEIRQEVFGQNSLD
AMLQVTTDSMLPVYFREPYTSLLQALVLDDSMAAPSLFAHRDFPDFLRLCMIDTVRYVQL
LGGSSVFPEVEEELERREDAALRCPPKNATEEEMNEARFGCGAYESFFFGPLCACLQRVC
ARYRSGVSQLSNRVRTQLEGAINEVVDALCDVMQQVLAPRSPSAVLSEPTTAGVNSTRAA
SVTTAPFPETQWTEQQTTILRSCVWVAKENGFSGTARWRGAAFAQVCSRLDAYIETMTTA
TTTVKAPPPATGSSKDASDVAASTQDGANVLTGKWTTYLRESLLSDPRMAEENRLLSAAG
ILLRCGVRGTIFARMLFTVMPSLQRYYLVSILTLVRQLVVLAPNNPYDDSALLPLHLQDA
DMPFITITTSVPSRQSFLARWPGDTSLEVPVPLIAVVSEFIGFGKHDVQRAALLAGCTLL
MKGNRSMQECFYSYCRRSANEQLFFVLRNHLIEFKDELRTYYHALANGGTPSEAVHYLSQ
MENCRLELRLLQLLCAGQYAPLQTYLVAQPDNNISVNVVEALVELLSMAPKTANEETSDF
MLQLLSTTAESLQGPCLINQDTFVAYNAADYLTLLLSEYDPFVNPDAVFSSVETVVRRVP
WYEARFGAKHKKKREAALVEEARRRCRNLLQTMALSTLLALIEGRDDSAFASKLISTVDL
SVLGRSMDRSAATYEARHGSIVRSQTRGLLRGDVEGCRAVLARYLRDYIHSDYPTGRQEL
QDELALAVSIYTFFRACHDMHTLAVLRSHRAGTAAQHRRGVSQDVDEFVDKKGQSIRQVL
RKTRSYRQVATKLAKIEVVRDGRLERVYFRMLNTALDNLLHYRKQHLIASAVRTSDNERI
QYFFNKGSEVIVEVAWYARLRRCLLLFMMNFFSSEINAVGLAIVLAINLVMVIGIRAPTS
PYEDGTSDGINRALRALGIADICVQGVLVIQAFFGPAIVSYKIGWQSWKSSKASRLTKRA
DNDIAADRGEVLQRGEDTMRPTWYEYAVYSLYFIFTDGLFLLQAFFLFVSIMGFVHHHIW
YGLQLMQVSLSSPVLASLFTALANNAASLVLTLALLLIFVLFFAIISFYKFSDLFNPLST
RNNGFNCYTMSQCWLVHVDTLRSSGGIGDVMDWPIFYSKDGFGYWTEFFRMCYFVVVNLI
GLNLFLGVIIDSLAQYRLEQQFVKTDQEKKCFICGIERNVFDVVQPGTYDTHIGEEHNMW
QYLFFLHYLSEKDPESYTGQEAYIHQQVLYRDVTFYPIGKSLVLGAMEGGDAPSSKADTG
ASRGSGGGGGGGGDDGAGADDATAQAVLTLVEVALKTSIDPLKRKLEEMAESVHEVKEKL
MPSGGSLESTSASAHPRGIGDAVHPDRSPYGRTRRTRR
Download sequence
Identical sequences A0A0N0DTZ2
XP_015656243.1.39912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]