SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0FL54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0FL54
Domain Number 1 Region: 12-195
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.79e-55
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N0FL54
Sequence length 199
Comment (tr|A0A0N0FL54|A0A0N0FL54_PSEYM) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=59511 OS=Pseudomonas syringae pv. maculicola. GN=AC507_4978 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKTHFGADLPIVDAIVVGASAGGVEALLRIFSALRPGFSLPVLTVLHLPDDRRSQLAHVF
QNRLQIPVKEADDKEDIVPGTLYFAPSSYHLSVESDRSLSLSQEDRVFYSRPSIDILFDS
AADAYGSRLAGVLLTGANNDGARGLLQIRKHGGFTVIQDPLQAQASTMPEAALALHSPDY
LLSLTDIGRLLVELERTAC
Download sequence
Identical sequences A0A0N0FL54 A0A0P9HJ83 F3HPB8
WP_007251814.1.52488 WP_007251814.1.75137 WP_007251814.1.93459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]