SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0JA61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0JA61
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.000000000000929
Family Ribosomal protein L36 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N0JA61
Sequence length 41
Comment (tr|A0A0N0JA61|A0A0N0JA61_9RHIZ) 50S ribosomal protein L36 {ECO:0000256|HAMAP-Rule:MF_00251, ECO:0000256|RuleBase:RU000571} KW=Complete proteome; Reference proteome OX=1523420 OS=Rhizobium sp. AAP43. GN=IP76_05365 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MKIKNSLKALKARHRDNRLVRRKGRIYIINKQNPRFKARQG
Download sequence
Identical sequences A0A095WXN1 A0A0N0JA61 A0A0N1ATE5 A0A1B3NYR9 A0A1E3Y487 A0A1N6RCL5 A0A1X7CY16 K2PD10
WP_006726873.1.15537 WP_006726873.1.20042 WP_006726873.1.4329 WP_006726873.1.43531 WP_006726873.1.53509 WP_006726873.1.68289 WP_006726873.1.81893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]