SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N0PAE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0PAE5
Domain Number 1 Region: 328-462
Classification Level Classification E-value
Superfamily MIR domain 1.28e-42
Family MIR domain 0.00000163
Further Details:      
 
Domain Number 2 Region: 105-192
Classification Level Classification E-value
Superfamily MIR domain 4.71e-16
Family MIR domain 0.018
Further Details:      
 
Domain Number 3 Region: 207-268
Classification Level Classification E-value
Superfamily MIR domain 0.0000112
Family MIR domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N0PAE5
Sequence length 462
Comment (tr|A0A0N0PAE5|A0A0N0PAE5_PAPXU) Inositol 1,4,5-trisphosphate receptor {ECO:0000313|EMBL:KPJ04580.1} KW=Complete proteome; Reference proteome OX=66420 OS=Papilio xuthus (Asian swallowtail butterfly). GN=RR46_01023 OC=Papilionoidea; Papilionidae; Papilioninae; Papilio.
Sequence
MGDSFLHLGDIVSLFAEGSVSGFLSTLGLVDDRCVVCPEAGDLTDPPKKFRDCLFKICPM
NRYSAQKQFWNTAKQSANANADTDTGLLKRLHHAAEIEKKQNELENKKLLGTVVQYGSVI
QLLHVKSNKYLTVNKRLPALLEKNAMRVHLDANGNEGSWFYVMPFYKLRSTGDNVVVGDK
VIMNPVNAGQQVLHVSSSHELPDNVNKRLPALLEKNAMRVHLDANGNEGSWFYVMPFYKL
RSTGDNVVVGDKVIMNPVNAGQQVLHVSSSHELPDNVGCMEHDVLLKTTSRTCWEVEVKQ
VNVVNSSTSWKVTLFLEHKENQEEILKGGDVVRLFHAEQEKFLTMDEHQKRQHVFLRTTG
RSSATAATSSKALWEIEVVQHDPCRGGAGHWNSIFRFKHLATGHYLAAEACLKAPDAPLE
SGEPAYQLVSVPHSSEIATLFELDPTTMTHSDAAVPQSSYVR
Download sequence
Identical sequences A0A0N0PAE5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]