SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0PD96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0PD96
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily BEACH domain 1.27e-22
Family BEACH domain 0.00031
Further Details:      
 
Domain Number 2 Region: 107-173
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.8e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N0PD96
Sequence length 176
Comment (tr|A0A0N0PD96|A0A0N0PD96_PAPMA) WD repeat and FYVE domain-containing protein 3 {ECO:0000313|EMBL:KPJ16301.1} KW=Complete proteome; Reference proteome OX=76193 OS=Papilio machaon (Old World swallowtail butterfly). GN=RR48_00799 OC=Papilionoidea; Papilionidae; Papilioninae; Papilio.
Sequence
MIVCSYLVRMEPFTQHFLRLQGGHFDLADRMFHSIKEAWNSASRHNMADVKELIPEFFYL
PDPAAVTAVAAARSGRGLAVGDARGRIFRWSAPDMSSAAGAKGGPADHWIRDDTAPFCTQ
CQVRFTALERRHHCRECGAVFCGRCTRYEAPVSRLRALRPVRVCQRCHDNIHGKKE
Download sequence
Identical sequences A0A0N0PD96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]