SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0U2R2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0U2R2
Domain Number 1 Region: 33-140
Classification Level Classification E-value
Superfamily HSP20-like chaperones 5.93e-32
Family Co-chaperone p23-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N0U2R2
Sequence length 200
Comment (tr|A0A0N0U2R2|A0A0N0U2R2_9HYME) Uncharacterized protein {ECO:0000313|EMBL:KOX67174.1} KW=Complete proteome; Reference proteome OX=166423 OS=Melipona quadrifasciata. GN=WN51_09418 OC=Apoidea; Apidae; Melipona.
Sequence
MKHTLTEDCLHTIAWKSYTTTRVNYINYIKLPPPPVMWAQRREILFVTICLEDCKDPVIN
IEPQMIYFKGIGGTEQKMHEVTINLYGEIVSDRTIQNLRGRTLELVLFKKEEGPYWPRLT
KEKTKAHWLKSDFNKWKDEDDSDDEGGMEGSGNDLEEMMRQMGGLGGTGDSKPNFDDLDA
LGDEGEGMDSDDDDLPDLLE
Download sequence
Identical sequences A0A0N0U2R2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]