SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0YER1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0YER1
Domain Number 1 Region: 305-481
Classification Level Classification E-value
Superfamily DNA-glycosylase 5.23e-42
Family DNA repair glycosylase, 2 C-terminal domains 0.00018
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Ada DNA repair protein, N-terminal domain (N-Ada 10) 1.7e-29
Family Ada DNA repair protein, N-terminal domain (N-Ada 10) 0.0006
Further Details:      
 
Domain Number 3 Region: 201-296
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.1e-26
Family DNA repair glycosylase, N-terminal domain 0.0029
Further Details:      
 
Domain Number 4 Region: 137-185
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000309
Family AraC type transcriptional activator 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N0YER1
Sequence length 497
Comment (tr|A0A0N0YER1|A0A0N0YER1_9ACTN) DNA-3-methyladenine glycosylase {ECO:0000313|EMBL:KPC79078.1} KW=Complete proteome; Reference proteome OX=1519471 OS=Streptomyces sp. NRRL S-4. GN=ADK82_27000 OC=Streptomyces.
Sequence
MHTDTERCVRAVQSKDARFDGWFFTAVLTTRIYCRPSCPVVAPKARNMTFYPSAAACQQA
GFRACKRCRPDTSPGSPEWNARADSVARAMRLIQDGVVDREGVPGLAARLGYSARQVERQ
LLAELGAGPLALARSQRAQTARVLIETTGLPMAEIAFAAGFSSIRTFNDTVREVFALAPG
ELRTRAARGRRTPGSPGVIALRLPYRAPLNPGNLFGHLAATAVPGVEEWRDGAYRRTLTL
PHGHGIVALSPQPGHIDCRLSLSDPRDLTRAISRCRRLLDLDADPVAVDDQLRSDPLLAP
LVDAAPGRRVPRTVDACEFAVRAVLGQQVSTAAARTHAARLVRAHGTPIEDPEGGLTHLF
PTPEALAGLDPETLALPRSRRTTLTTLVAALADGSLRLEEGADWDQARTELAALPGFGPW
TVEVIAMRALGDPDAFLPTDLGIRRAAERLGLPSTPAALTARAAQWRPWRAYAVQYLWTV
DDHPINHLPVRGREDES
Download sequence
Identical sequences A0A0N0YER1
WP_031089691.1.49592 WP_031089691.1.52350 WP_031089691.1.76928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]