SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N1CY54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N1CY54
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily Transthyretin (synonym: prealbumin) 7.33e-42
Family Transthyretin (synonym: prealbumin) 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N1CY54
Sequence length 117
Comment (tr|A0A0N1CY54|A0A0N1CY54_9PSED) 5-hydroxyisourate hydrolase {ECO:0000256|RuleBase:RU361270} KW=Complete proteome OX=1690246 OS=Pseudomonas sp. RIT-PI-o. GN=AEQ63_20580 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MGRLTTHVLDAAHGCPGSSIKVELYRVEGSHLELVASATTNSDGRVDAPLLQGDDYRTGV
YQVQFHAGDYYRARGVQLPEPAFLDVVVLRFGISAEQEHYHVPLLISPYSYSTYRGS
Download sequence
Identical sequences A0A0D0K5F0 A0A0N1CY54 A0A142N829 A0A1H2J3V1 A0A1N7DZ69
WP_041479332.1.17790 WP_041479332.1.24892 WP_041479332.1.36605 WP_041479332.1.46469 WP_041479332.1.51654 WP_041479332.1.65847 WP_041479332.1.74421 WP_041479332.1.95481 WP_041479332.1.96516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]