SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N1PDU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N1PDU9
Domain Number 1 Region: 881-950,1021-1096
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000012
Family IP3 receptor type 1 binding core, domain 2 0.011
Further Details:      
 
Domain Number 2 Region: 537-582
Classification Level Classification E-value
Superfamily MIR domain 0.0000863
Family MIR domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N1PDU9
Sequence length 3823
Comment (tr|A0A0N1PDU9|A0A0N1PDU9_LEPSE) Uncharacterized protein {ECO:0000313|EMBL:KPI87904.1} KW=Complete proteome; Reference proteome OX=5684 OS=Leptomonas seymouri. GN=ABL78_3014 OC=Leishmaniinae; Leptomonas.
Sequence
MDRGRQTVKFYGLIYFQCKDGYLAASGLDGERLYLRTPPVVGDTADESLPFFGFADACLF
RVVPTLSSLAATSSVKGASGAVSSRNLRGGVAAEENAEGTTASALSGLNDFHFDPRKTAD
IIDVEEITYGKSFSLVHEASGLFVGVANALPSENDPDCLSVVLVKPSAAMTPSCELSLVS
RYKIHTEGDKLCRADSILIRLAASPMFLHVSSSPIMEPRGDNGGDIELLHRTFRFGSSLA
YTERRHLGPGSVGVAATAAAMAAQGCNLNLQASFVIPTEHTVTALERCSTDIAAEALTRE
YLDEVNACEEGGVSFTIHRYDMGTDRANRQRTQLRIARPYVACGVPVALYHRERESFLMS
SAAQLSGPTEVEEERDRECSNSPSPVTEDLNATSGSTVPPSKLCRVTIENAGEIDAEDGL
PMPVLKSRQNKSTLNGVSAIGGAEAAIRRTTTAAAAATSHWRRRSVLSNTTSEGTFAYSL
NATLQFQEQQHRARVLRTEGLIDTGRGRFFPFPVFTATKPEHTTASEDLSLLDTNHNCTT
LWCFEHEEPMLGGPLRYGSSWRYRIRHVVSGMYLAVCGSAVDAMLEEDEEDNESAKQATM
RNSVRTMSPASTASSTSTTAGADEMADGANGPGTSCSTSLSGRIRATAFASALATPRPAP
TRETSLCLIPQPRTRKELQSTVFFIEPMYATDSAYLIEQTCLSIKNALTEMYVVTDSNVD
GSNISLSLDWQPSPADPIIVSYVPHRLQLDTRFVASQCIWLARYRAEMQALVLEHQKRRS
ATVAAAMAGDEEAEKTLAAEEAYRSALPEMTRPYFNTADLDMELLKIHKSFVPRSSTSRE
WVENFSATYSSAALANNWNITGSRGGIVGFDKGAFAMEEPIMGQKKMPYASMNNTIRLCQ
RALIALLEFCTESDETNVLRREGLPIKSRQSLFYEMRFHRLLFDVIVAPFQLLHSTNAEV
YGTYSSVVNSIAALMKSDHGSFDQIYETLRMAQHQQADLSCIWSGVWFSSAAASAMPQTN
FKDSGEGLLDVRELMLPMHRELHLLTRLAVRLLRQSIRDNAATFTAGWSVHIPRLLQLDG
LRLHVVDAMRELFTDNPYIPLRAVHQVLDHFISVSKHVRRGTYMDFLGAACTIKYKGVPE
RQAFVCQRLLVENPQSLCRFVIVVPPGKAESEGRVYILPNLDPDATTDSDREDPRKNNEF
FAASHRRVSGMGQGAFASAVPFPSHHPHPHTGDTEADGDDGICAAPPPGYLPFTEFFSSK
TDKKKVTFVSNQIALFARLCYDGCPKMCRDVVGRLFPPAAMKSLLRNFVWTGKQVVGNRC
AHDALRNFLIRLAMQCFVLPRMSAPAVQLRVNTVLFGSSQLRQSTCPTYSGLPDDEMTLI
LKSVVVELLRANPFFVQDDTDRSLLMRGAVSVWLKLTRYQQYTHEEVLTVLPMLLQLLDG
TRDVLGTPTLLHTNLPPTGAGVRSRRPTGPRAGSRNSFVLPSPLAAMASASVFSSRSTSR
LARNVESVHLMRIREMICQALFLALQHEVFHAADNIIVNLYKAYTQPDTNRHDTVQSSSA
AARVWGAVQQKVGDLTASRDGSNSGSSNEQSPLLGLYGSGSVTMSSGDAAMHEEEARKTS
LAAQRQADGYHEIADSSQSSILVSGGAPVNAVLQGSEMFSASWTSQLIRTEASSAYAELS
SSDDDENTLPAANGVSGGGDGKPGSGISAAGVQAILDYHTHRITEYFQPPRLVPYLFDIA
RYGCGPLTAQAMALLVQLCVVKRSIAQLVLKVNTLPSSEVLRSFDCMYRVAVQLKEVYEN
VAPGTPRATQWEPAIQFALDALNGQHPPPPLDIDADAGGATQKLLQRESGGGGEGGVSQR
ASLPSKSRHDSSAASRLKVSFRRMYRSFHEGIAEDVLPSDSDEESEGHEEVGLAEEGGAA
AEEKDSGGTPDSEEASPSEPAGLNRQQDRRTALWSKTAGAVRMLAYNTAIRNRRRALGLS
ETSTIPVNVIVRAEMMAHWKIHESLLQMLSQLTLADPIFKSVLQFFYFFSFSESNSLLLQ
PYVKLFVDKLDPAGASDTVCLQIIVRILRSKPHVEDYLTPELLAAVAKHIHDELHTKLPD
PELVEMLSEYIFSKSSLSPVVRRRMMILFREHGTLMTLARFRLNPTPAEVVFTSALVNLV
CSICGSYTSVLTLARSMLPAENICNVILQNRIVESLPVAIVDWSRSSQAASSSFDSSTTL
GSVAALKLLNPYVRILVALYFIPKNDTQDDNRCRCLLWMGNAKLWGIVKLFTNTMEAVSN
AIEQDGNTQVVNRGLNGVKAYRTLLCSTIPVAMAGFFMNCFSNEGFIRFQSEVIEKKFYE
LVAAAERFGSLLVQHVATINLTVEEVVNYRRFLGVLCKRLVELNDPSAVDKQKLAERCVT
TKRRMRAWLSEQQRVLESALVEMEDVRAGAMGSAAAAPGPRVENSKVAQDNSAASFSISS
SVDSFMGLRKPIASTSATAAAYVNNVLRRKARTDDDISAFRLLFAEEAVSQAQLHSQEVL
EAAGLGGLGARILDSPCPNREPEGADTSGFNNIGLLLPGVLASSRGVSAVRASLRATLHG
DSIIPSVRRCPSEVSTIAVQRLLHSAHDECMRGSIVCILEAMRNHLFRPRTFVGVLNLFS
NALDTALHYPDLVKALCGSGLTVWSDSAVSTPQTASPSLRVPAAVATKGFDGEGGAGVWN
PDSTVAPESLGYALQSTFNDAGMLNVVISLCGLEEDVISLNAIRLGVLILEGGNRHAQSR
LLAYFLTREEGFFHNVRDILRKNLSWVEHINAEHQYYLMKRGMHGEESKGTTAAANIQII
NALTPKQNGGGTSAVDTNLEVFTASKSYVSSLHGEQRKWLATLRSATQVSGWARVRGSRR
LKLITFLFRFLQLFCEGHFAGLQNYVRSQHDNLHSANVIIETMAFMEEMSTFVTPSNHRV
LSQGFELLTEVCQGPCRLNQEALIDYGVCRVIRHLVDYLQTQSGGDSRELAALLKTISES
SSLQQHPPHCKQFTRSQDDKMEAVERDVMNQLGESEAAQLRVSISNTLLAVLEGCREVEA
YRRVLRQIPLTSVAVEVQDAFNPATIHLLHHDEDAFEKDDRMEAMFNWLIFLKSVEPYAE
LEGVLEGVQTLLRSSEAVSRYLSSIEVRRADGLERVHFRIPLICQSLTQERKDELLWSVD
RTSRATKLADFLHKSDAIIFAVERNHAFHKHVARWTRFAITYYDEAARARQGGLRRSVRS
MKLFYNNYVAAKLFPYELAAYDMVSMTLAVLSNSILVVLKGGDSSSKSTVQVYGDRLISV
LCALQVVVCSFMFLVYLNLLFPIHLYNVYKNKQRFTVGKVRINVALEEVYTNLTVRERWG
SFLGWFDMQFRITLLFFAILSYIVSHYFAAFNLMLAVYSIPTLRTFISAITMNGKQLLLT
SFMGIIMLYLFSIVGFLVFANQYNPDGGEAGSASTGQHMNCESLLQCFAYILDQGLRAGG
GVGDVMLPWTWDNSRMLARLAYDMLFYALVTVVFLNILFGLIIDTFGQMRDEKREKEADM
HGFCSICGLDADTLEKNSVMGFANHVKQEHNMWMYLYFIHHLRRKDSSEYTGQESYVSAC
IQRSGLSFFPEGNCISLIEQRRLEGEELNALEEDDEDTANNDGKSDETVDAAARLAMKEL
TAARETISAHIKEWQNDSMRMKALLQQLELTLRSAAMTGTNAAGQGCGAVSVRSGQTLPR
SAKAETIIPSDAAAMEMQTMLEYSSSSNIGGLLNPRLAMESSTSLSGAEAPGLRAVQAQL
QAERELRQRCEQERRKLKAALKAKETELTKLKMLGSQSNDDAA
Download sequence
Identical sequences A0A0N1PDU9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]