SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N4UDD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4UDD6
Domain Number 1 Region: 12-69
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000107
Family ATI-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0N4UDD6
Sequence length 75
Comment (tr|A0A0N4UDD6|A0A0N4UDD6_DRAME) Uncharacterized protein {ECO:0000313|WBParaSite:DME_0000533901-mRNA-1} KW=Complete proteome; Reference proteome OX=318479 OS=Dracunculus medinensis (Guinea worm). GN= OC=Spirurida incertae sedis; Dracunculoidea; Dracunculidae; Dracunculus.
Sequence
MLLTICAVYSDKKCGKNEVKSDCAGCELKCGQSKNKLCTTICRFKECYCSPHAYRRNASG
KCVRISECPRRKRIG
Download sequence
Identical sequences A0A0N4UDD6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]