SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A0N4V2Y0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N4V2Y0
Domain Number 1 Region: 445-616
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.71e-44
Family IP3 receptor type 1 binding core, domain 2 0.00000747
Further Details:      
 
Domain Number 2 Region: 231-443
Classification Level Classification E-value
Superfamily MIR domain 9.59e-42
Family MIR domain 0.0000197
Further Details:      
 
Domain Number 3 Region: 1167-1285
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.88e-23
Family IP3 receptor type 1 binding core, domain 2 0.0082
Further Details:      
 
Domain Number 4 Region: 88-146
Classification Level Classification E-value
Superfamily MIR domain 0.000000011
Family MIR domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N4V2Y0
Sequence length 2709
Comment (tr|A0A0N4V2Y0|A0A0N4V2Y0_ENTVE) Uncharacterized protein {ECO:0000313|WBParaSite:EVEC_0000438201-mRNA-1} KW=Complete proteome; Reference proteome OX=51028 OS=Enterobius vermicularis (Human pinworm). GN= OC=Oxyuroidea; Oxyuridae; Enterobius.
Sequence
MTENGSKKLVDDRCIVENGDGGPESPPKKFRDCLFRICPVNRYAAQKQYWTEQKKFQAGE
SVFEEDMLKKLKNAADKEKEQNDMEYRKMLGVPVQYGGTIQLLHVKSDKYLTVMKNSPAK
LERNAMKVYLDKTGNEGSWFFVEPVYKHSFLGDSLTKLQVNAGDRISLVPYSYGSASGAG
SHVKPQIHLSHMKLLDHPTACEVNCLNELTEWQVFMFLQFDENQPDIVKSGDVVRLFHAD
QQTFLTLDNIPKKGDDVVFLRLTNRPSAADATSSRALWEVQVVQQEAYRGGAANWIQRYR
FKHLATDMYLSVEGVRRDGLREMPKATTPPATLNISDETENSEGLPEDEYDYYYLVPKNS
ERPEDDPTLIFVLDPCTLTKMEARIPQRTYVRLHHVMTKTWVHTTDPTKKENLYHFSKNE
KGWVKVVSENFKIDKETFALLPVSPDEVRDLDFANDACRALDNFISHIKHGQIISKEALN
VTVQLLTECIYFVTNETNHMIDPLKIVDFKPSRDRQKLLREQGVLAQIFDLLRAPFLPRQ
GDNEIGPLLNSPQELAEQRNEVFKRMFQLCYSLLRYAQVGYRKNQEHLAEKFGQIQEQIG
FDLLAEDTMTAVLHNNPKLLEKYVKNPHVERFVELVRNNRAGKFLDYLADLCVCRGEANK
KIQELICNCVLSEANRDIFMETKVAVFRGKEEVFICWADRYCKTLVDISESAVAGNSEDL
EMLEYYRHQLDLLAQMCQEQQYLAIDPPPERRLLNLSTELPAELVLRCMSDSRLPHELRA
SFTRLMLHLHVVRGSPLNAIRHARLWRDIPETVSVEQASIRLVEGYVDGGRVRTGGEVFK
KILAMVDEYLDGLRAATRKGEAVLNPSAAYLDQNRLTFEIVTLARALAQFGFYSFAELLK
LAQNLLAITDSNPKLPPGKDLSMTKSFTYLAIGVGRMHKVSLPTSHSMASESLSADDGVR
AKESKEMILQTKLIVVEILQFIMDVRRDYRITVALSWFKRHFPCDEVGELTAHIGELSEK
QAAELYKEIFQKSEEELDFDGEEGQQLLRILLQMTMSDYSKLTSTALKVLFRHFTQYQEL
VEDLKQVQLLVSNNDVENYRQVDRDLFILKILTEKSELWVHADKLRSDEINELNGRVYDE
TLLYDKVQLMIGEDRESAAAALYELSDKAPLVGYPLIREILCRLKNLCFKDGKPDIMNQQ
LLRNMRVHEYVLDFLSVPYNKKNDMEMPKLITLSHEFLRSFCRNNKENQIRLQKHISIEQ
DAKEGCLRVNTAEEVATLVAIYQNNRELSQTVSEELIAHVVSLIEHKARSAIFLEFLQCI
VCVSGKEICSSQEKVALEICSSSDEVRVFYSDSASFEQLVQMMQTTPPEQLNADHPLRYH
IELVRLLAMCTRGKNGTTELKCASQIPMDHIVRVMTSPKCLIQVKEVYLQFMLHCYVDTD
AEMKDVYNVDFIEQILSNIVVDIQKLGAQSHRLLPGSALEKYVCYTVTEVLIKFFEKSPT
DQPMMDVSKIYLKQNRSTLAKVIESLTRLQMEWGKKSNSAKSWYRVVECVKRLHKCAEEH
GIILSSNTPMNPVSAAATAKQRWQTAAHSTRFIKRNQANIRNRAQLSMPHFSRTIENHTN
VVTCYQAMVGEFKVFALPLQAAEASVLVDVLHTPERLFPVGSELREKCENGGVVAKLIQH
CQHLLQHSQESLCVRVLQTLCRMATSAKHNFNQQGRRVRRQLLERYFGSEAVHGGPLKVE
SEKDDLHPDEESNLVHGELKPLRETSLFDVQCKLNNAGASDLVIDLIVQEPSHEVFFMTI
QLAKALLHEGNNEVQMSFYNRLKRRNVSEPFFNALKTKLQMAQNRLKSDMMACSDPRQRG
LGRVICLTLIIQRLRETKTSTINTPQPDDTVFSSEDIERKSRAPSVSELNISATLPPDSL
PMGCSVHEPSPYQEDERPKGILPAEVAIIEPILRFLQLLCENHNLLLQNFLRYQNSRQNY
NLVDETLMFLDVVCGSTKGSLGVFGELGEHNFSLVKQTLVTLTEFCQGPCHENQNAIGNH
ESGLNMIISLVLNEIKPLCISHMDLALEIKSDASKLLLAVMESRHDADNAERVLMNMSHM
TSGPRQLVHAIKVAYEMASSHNFAVSKVRRQLLGNPSSSGEGRRRTNTVPEISVPSTSTD
EYEPKESTSTLVDPQEVGHNIFILATQLSRHDEELKLMLDPENCKDQMTRTALAYYNKHT
AQIEIVRSDRKMERVIFPIHTICEYLTPETKQNVLLETERDAQGSKITEFFDQWPTLYEE
MKWQKKLQGLFLASLGRTTEAYWGIAAVMFSFTMLLINIIGVVPTLYIVGVLQLVNKVVH
LISYVGNRGLIDKTWMERVEDKDIWYHLLYLSVCVLGLIGHPLLYSLLLFDIVASEETLR
SVIRSVTRNWQSIIMTGLLALILVYLFSIVDFQLEIDNIDQMTEDSLPKGVTPVQCENIS
SNFLENMTRAEGTCLALDVPSSNEEKEDDGKIWSCQTLRMCILTTLNWGLRNGGGIGDVL
RNVPPKEESFMPRIMYDMSFFIVLIVIVLNLVFGVIIDTFGDLRTERNEKDDILRNTCFI
CGLERGRFDNKIVTFEQHRENEHNLYHYLYFIVWLQIKDETEFTGPESYVAQCIKDRNND
WFPRMQAMSLAEDDQETELPEKKSDVKDMIESLLNIIKSHDRQLDEIKQLMYEQLQMRSL
PQARKGRIG
Download sequence
Identical sequences A0A0N4V2Y0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]